Recombinant Human Catechol O-methyltransferase (COMT)

Code: CSB-CF005779HU
Size:
20μg
20μg100μg
US$4522
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: 10xHis-SUMO-tag
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
COMT
Uniprot NO.
Alternative Names
Catechol O methyltransferase; Catechol O-methyltransferase; COMT; COMT_HUMAN; EC 2.1.1.6
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-271
Target Protein Sequence
MPEAPPLLLAAVLLGLVLLVVLLLLLRHWGWGLCLIGWNEFILQPIHNLLMGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Catalyzes the O-methylation, and thereby the inactivation, of catecholamine neurotransmitters and catechol hormones. Also shortens the biological half-lives of certain neuroactive drugs, like L-DOPA, alpha-methyl DOPA and isoproterenol.
Gene References into Functions
  1. There was no significant genotypic association between rs4680 and clinical symptoms or cognitive function in Han Chinese patients with schizophrenia. Patients with GG at rs165599 scored significantly higher on the Stroop test, suggesting better cognitive performance after 8 weeks of treatment. The findings suggest that the COMT gene polymorphisms may influence the response to antipsychotic treatment. PMID:29634613
  2. These findings suggest that the association between COMT polymorphisms and cognitive functioning could be, at least in part, due to their association with varying levels of S-COMT. This is important as, unlike MB-COMT, the substrates targeted by S-COMT are likely to be intra-cellular rather than, like dopamine, located mainly in the synaptic vesicles or the extra-cellular space. PMID:30218069
  3. The COMT gene rs165599 SNP does not appear to be a single-risk factor for schizophrenia. PMID:30165727
  4. An interaction between the COMT genotype and childhood adversity, affects executive function in adolescents. PMID:29222971
  5. that the presence of one or two Met alleles of the COMT Val(158/108)Met might act as a protective variant in working memory tasks in combat exposed veterans with posttraumatic stress disorder PMID:29248614
  6. Association between COMT Val158Met polymorphisms with antisaccade task performance in schizophrenic patients. PMID:29429137
  7. variant and temporomandibular disorders may contribute to individual variation in electric and cold pulp sensitivity PMID:29550002
  8. T-77C and Arg399Gln polymorphisms of the XRCC1 gene, as well as the 186C>T and Val158Met polymorphisms of the COMT gene, increased the risk of lung cancer in non-smoking women. PMID:30109864
  9. COMT-GG and NRG1-AA genotypes aid the transcranial direct current stimulation-induced improvement in auditory verbal hallucinations in schizophrenia patients. PMID:29559020
  10. In those who had used cannabis before 20 years of age, COMT Val158Met polymorphism had a trend level effect on age of onset of psychosis (median age of onset of psychosis : Val/Val < Val/Met < Met/Met 19.37, 20.95, 21.24 years, respectively; log-rank test p = .051). PMID:29201551
  11. findings support the hypothesis that G x E interactions underlie associations of COMT val158met with fear inhibition deficits PMID:28833952
  12. COMT gene moderates the relation between maternal history of maltreatment and infant emotion regulation. PMID:28803562
  13. Its single-nucleotide polymorphisms involves in dopaminergic metabolism and motor and cognitive function in older adults. PMID:29525179
  14. COMT DNA methylation level is affected by the severity of the clinical symptoms of schizophrenia and might also be influenced by pharmacological treatment. PMID:29160620
  15. The present study showed that females with middle dopamine availability (valA/valB or met/met) and evidence of emotional problems in adolescence were more likely to have affective symptoms at age 53. PMID:29331705
  16. findings suggest that Val/Val homozygous individuals for catachol-O-methyltransferase (COMT) may be more flexible regarding self-attribution/body ownership and that biological factors may contribute to reduced awareness regarding the distinction between self and others. PMID:28251370
  17. Cloninger's (1987) hypothesis about negative relationship between novelty seeking and dopamine was confirmed on allele level, because higher novelty seeking was found in Val allele carriers comparing to Met/Met genotype carriers. PMID:29546858
  18. Study provides evidence for an epistatic interaction between ZNF804A rs1344706 and COMT rs4680 on the grey matter volume of the left dorsolateral prefrontal cortex, which may improve our understanding on the biological mechanism underlying the genome-wide supported variant ZNF804 rs1344706 of schizophrenia on the prefrontal anatomy. PMID:28078547
  19. Logistic regressions with interaction terms (adjusted for sex and age) revealed that comt rs4680 interacted with total childhood adversity, emotional abuse and physical abuse in predicting panic disorder. PMID:29574383
  20. No significant difference was observed in the RNA levels of CYP1A1 and SULT1A1 between the two groups. The frequency of expression of the CYP17 T/C variant tended to be higher and the A allele of COMT polymorphism together with down-regulation of its mRNA expression may be more frequent in Chinese women with idiopathic POI PMID:28887105
  21. Individuals carrying Val/Val of COMT seem to be more sensitive to the synergistic effect of environmental factors acting early in neurodevelopment. PMID:28262436
  22. childhood urbanicity and variation in dopamine genes COMT, DRD1 and DRD2 alters adult prefrontal function as measured by fMRI PMID:29634738
  23. None of the polymorphisms studied showed a reliable association with response inhibition performance. The methodological and theoretical implications of these findings are discussed. PMID:29155230
  24. the association between the COMT Val158Met and ZDHHC8 rs175174 single nucleotide polymorphism and the susceptibility to schizophrenia through a case-control study involving a population from the North Region of Brazil, was investigated. PMID:28562378
  25. Results revealed a sex-specific effect of COMT on corpus callosum (CC): in males only, Val homozygotes had significantly higher fractional anisotropy (FA) compared to Met-carriers. Volume-of-interest analysis showed a genotype by sex interaction on FA in genu and rostral midbody of CC, whereby Val males demonstrated higher FA than Met females. PMID:28948081
  26. No association between self-reported non-recovery or pain levels and COMT haplotypes in in a Northern European patients with acute whiplash injuries could be detected. PMID:29195501
  27. The aim of this study was to investigate the effects of the interaction between the CYP 2A6 and COMT genes on smoking behavior in young Taiwanese men. The odds ratio for starting smoking was significantly lower in subjects carrying a CYP2A6 low activity/variant COMT rs4680 genotype than in those possessing a CYP2A6 wild-type/variant COMT rs4680 genotype (0.44, 95% confidence interval = 0.19-0.98, P = 0.043). PMID:28472995
  28. Results show no association between TPMT or COMT single-nucleotide polymorphisms and cisplatin-induced ototoxicity. PMID:28445188
  29. Study applied graph theory analysis on resting-state fMRI of 120 women selected based on neuroticism score, & genotyped 2 polymorphisms: 5-HTTLPR (S-carriers and L-homozygotes) and COMT (rs4680-rs165599; COMT risk group and COMT non-risk group). The COMT polymorphism moderated the association between neuroticism and functional network organization. PMID:27743374
  30. The purpose of the current study is to test the interaction between prenatal maternal smoking and COMT Val(158)Met in conduct problems and crime in the 1993 Pelotas Birth Cohort Study. PMID:27426045
  31. We found no modulation of saccade parameters by COMT genotype in a visually guided control task. PMID:27793591
  32. Study used a mediation analysis to identify a gene-anatomy-cognition pathway to explain how COMT Val158Met polymorphism affects interference resolution capacity via modulating the gray matter volume of the left lateral frontal pole in healthy male subjects. PMID:27664968
  33. Findings do not suggest an additional impairment from comorbid alcohol and substance use disorders (AUDs/SUDs) on facial emotion recognition among subjects with schizophrenia, whilst COMT Val158Met, though based on a limited sample, might have a role just among those without AUDs/SUDs. PMID:28913946
  34. In a study of the genetic association between polymorphisms in the DAT1, SERT, COMT and BDNF genes and attention deficit and hyperactive disorder, transmission disequilibrium test analysis showed that no individual allele of any variant studied has a preferential transmission PMID:29122229
  35. There is an association between COMT Val108/158Met and schizophrenia in the general population (Review and Meta-analysis). PMID:27020768
  36. Val/Met polymorphism as a candidate gene variant to assess associations with subjective dimensions of hypnosis PMID:28836919
  37. A significant difference in the genotype distribution of the COMT A158G polymorphism was demonstrated, favoring the low activity genotype in patients with Polyneuropathy compared to both controls and patients without Polyneuropathy. PMID:28759974
  38. The present results indicate that rs4633 and rs4680 catechol-O-methyltransferase polymorphisms influence cerebrospinal fluid dopamine concentrations and methamphetamine toxicity in MA abusers. PMID:27987399
  39. The COMT variant (rs4680) was associated with poor appetite/undereating in an adolescent population. PMID:28694222
  40. The findings showed that a group of patients with a GG single nucleotide polymorphism (SNP) rs4680 in COMT required a significantly higher dose of morphine than a non-GG group. PMID:28985716
  41. For case-only studies, a significant interaction was found between cannabis use and COMTVal158Met, with an OR of 1.45 (95% Confidence Interval = 1.05-2.00; Met/Met as the risk genotype (Meta-Analysis) PMID:29444152
  42. To determine the frequency of COMT Val158Met polymorphism. PMID:28968204
  43. Analyses suggest that COMT val158met polymorphism moderates the influence of early life stress on preschool-age symptoms of anxiety. PMID:28859863
  44. Our study demonstrated nonlinear modulation of the interaction between COMT and depression on brain function. These findings expand our understanding of the COMT effect underlying the pathophysiology of MDD. PMID:28728097
  45. there is a relationship between Val158Met COMT and certain social cognitive deficits in patients with schizophrenia PMID:28856668
  46. meta-analysis suggested that the COMT Val158Met polymorphism was not associated with migraine risk (Meta-Analysis) PMID:27154995
  47. These findings support the hypothesis of a broad effect of the Val158Met polymorphism in the COMT gene on several dimensions of behavior and neuropsychiatric symptoms. PMID:28235603
  48. It is unlikely that the investigated genetic variants are clinically relevantly associated with depression after diagnosis of cancer. PMID:28590587
  49. In our study, statistical analysis has showed that in control group Val/Met COMT genotype was significantly higher compared with the obesity group PMID:28629779
  50. COMT 158G/A (COMT Val158Met) polymorphism was associated with suicide susceptibility only in females. PMID:28676589

Show More

Hide All

Subcellular Location
[Isoform Soluble]: Cytoplasm.; [Isoform Membrane-bound]: Cell membrane; Single-pass type II membrane protein; Extracellular side.
Protein Families
Class I-like SAM-binding methyltransferase superfamily, Cation-dependent O-methyltransferase family
Tissue Specificity
Brain, liver, placenta, lymphocytes and erythrocytes.
Database Links

HGNC: 2228

UNIGENE: Hs.370408

KEGG: hsa:1312

STRING: 9606.ENSP00000354511

OMIM: 103780

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products