Recombinant Human Carnitine O-palmitoyltransferase 1, liver isoform (CPT1A)

Code: CSB-CF005922HU
Size:
20μg
20μg100μg
US$8271
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CPT1A
Uniprot NO.
Alternative Names
CPT1A; CPT1; Carnitine O-palmitoyltransferase 1, liver isoform; CPT1-L; Carnitine O-palmitoyltransferase I, liver isoform; CPT I; CPTI-L; Carnitine palmitoyltransferase 1A
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
2-773
Target Protein Sequence
AEAHQAVAFQFTVTPDGIDLRLSHEALRQIYLSGLHSWKKKFIRFKNGIITGVYPASPSS WLIVVVGVMTTMYAKIDPSLGIIAKINRTLETANCMSSQTKNVVSGVLFGTGLWVALIVT MRYSLKVLLSYHGWMFTEHGKMSRATKIWMGMVKIFSGRKPMLYSFQTSLPRLPVPAVKD TVNRYLQSVRPLMKEEDFKRMTALAQDFAVGLGPRLQWYLKLKSWWATNYVSDWWEEYIY LRGRGPLMVNSNYYAMDLLYILPTHIQAARAGNAIHAILLYRRKLDREEIKPIRLLGSTI PLCSAQWERMFNTSRIPGEETDTIQHMRDSKHIVVYHRGRYFKVWLYHDGRLLKPREMEQ QMQRILDNTSEPQPGEARLAALTAGDRVPWARCRQAYFGRGKNKQSLDAVEKAAFFVTLD ETEEGYRSEDPDTSMDSYAKSLLHGRCYDRWFDKSFTFVVFKNGKMGLNAEHSWADAPIV AHLWEYVMSIDSLQLGYAEDGHCKGDINPNIPYPTRLQWDIPGECQEVIETSLNTANLLA NDVDFHSFPFVAFGKGIIKKCRTSPDAFVQLALQLAHYKDMGKFCLTYEASMTRLFREGR TETVRSCTTESCDFVRAMVDPAQTVEQRLKLFKLASEKHQHMYRLAMTGSGIDRHLFCLY VVSKYLAVESPFLKEVLSEPWRLSTSQTPQQQVELFDLENNPEYVSSGGGFGPVADDGYG VSYILVGENLINFHISSKFSCPETDSHRFGRHLKEAMTDIITLFGLSSNSKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Catalyzes the transfer of the acyl group of long-chain fatty acid-CoA conjugates onto carnitine, an essential step for the mitochondrial uptake of long-chain fatty acids and their subsequent beta-oxidation in the mitochondrion. Plays an important role in hepatic triglyceride metabolism.
Gene References into Functions
  1. CPT1A1A contributes to breast cancer-induced invasion and lymphangiogenesis of lymphatic endothelia cells via VEGF-C/VEGF-D/VEGFR-3 signaling. PMID:29940537
  2. We demonstrated that inhibition of CPT1 by systemic application of Etomoxir has beneficial effects in the treatment of depression in a highly validated CMS depression model. PMID:28526869
  3. These deleterious effects could be partially prevented by MCT-therapy and totally corrected by ETX. Inhibition of CPT1 may be view as a new therapeutic target for patients with a severe form of Mitochondrial Trifunctional Protein deficiency. PMID:28392417
  4. the expression of CPT1A was higher in oestrogen receptor (ER)-positive, compared to ER-negative tumours and cell lines. Importantly, overexpression of CPT1A significantly decreased the proliferation and wound healing migration rates of MDA-MB231 breast cancer cells, compared to basal expression control PMID:30092766
  5. We review here what is known and not known about the P479L variant and argue that public health action is premature. [review] PMID:28125087
  6. High expression level of CPT1A is associated with breast cancer. PMID:26799588
  7. The rs80356779, a p.Pro479Leu variant in CPT1A, was highly significantly associated with a range of fatty acid metabolism measures in a population-based sample from Greenland. PMID:28611031
  8. associations between methylation in CPT1A and lipoprotein measures highlight the epigenetic role of this gene in metabolic dysfunction. PMID:24711635
  9. Homozygosity for the arctic variant is associated with increased risk of infant mortality, which may be mediated in part by an increase in infectious disease risk. Further studies are needed to determine whether the association we report represents a causal association between the CPT1A arctic variant and infectious disease-specific mortality PMID:26820065
  10. We provide evidence that the downregulation of hsa-miR-124-3p, hsa-miR-129-5p and hsa-miR-378 induced an increase in both expression and activity of CPT1A, CACT and CrAT in malignant prostate cells. PMID:28671672
  11. The recent findings and the current understanding of fatty acid oxidation and CPT1A in cancer have been summarized thus providing theoretical basis for this enzyme as an emerging potential molecular target in cancer therapeutic intervention. (Review) PMID:27195673
  12. Methylation of a CpG site in CPT1A is associated with circulating adiponectin levels, likely in an obesity-dependent manner, in three population-based adult cohorts of European descent. PMID:28139377
  13. Furthermore, given the already low abundance of Cpt1b in white adipose tissue, it is unlikely that decreases in its expression can quantitatively decrease whole body energy expenditure enough to contribute to an obese phenotype. PMID:28330968
  14. this study shows that upregulation of the citrate pathway and down-regulation of carnitine palmitoyl-transferase 1 gene in cells from children with Down syndrome PMID:27502741
  15. Data show that in the absence of indoleamine 2,3-dioxygenase (IDO) inhibition, fatty acid oxidation increased along with increased activity of carnitine palmitoyltransferase I (CPT1). PMID:27667153
  16. our results proved CPT1A as a potential prognosticator and therapeutic target for AML. PMID:27916548
  17. High CPT1A expression is associated with ovarian cancer. PMID:26716645
  18. Methylation at 2 CpG sites in CPT1A on chromosome 11 was significantly associated with MetS. Significant associations were replicated in both European and African ancestry participants. PMID:26808626
  19. CPT1 is active on the outer surface of mitochondria and serves as a regulatory site for fatty acid oxidation due to its sensitivity for malonyl-CoA. CPT1a is the hepatic isoform. PMID:26041663
  20. the structure of the regulatory domain of CPT1C was determined (residues Met1-Phe50) by NMR spectroscopy. PMID:24037959
  21. Targeting the leukemia cell metabolism by the CPT1a inhibition PMID:26276667
  22. This large-scale epigenome-wide study discovered and replicated robust associations between DNA methylation at CpG loci and obesity indices PMID:26110892
  23. CPT1A inhibition with RNAi resulted in triglyceride accumulation in HepG2 cells. The CPT1A promoter region was determined to contain two putative Sp1 binding sites, namely Sp1a and Sp1b, which might act as the GBE regulation response DNA element. PMID:25183267
  24. The present study was designed to evaluate the involvement of hexokinase and CPT-1 in the cell growth and proliferation of human prostate cancer cell lines, PC3, and LNCaP-FGC-10. PMID:25501281
  25. CPT1A methylation was strongly associated with fasting very-low low-density lipoprotein cholesterol and trigylcerides. PMID:24920721
  26. High grade glioblastoma is associated with increased level of ZFP57, a protein involved in gene imprinting, and aberrant expression of CPT1A and CPT1C. PMID:24618825
  27. The results suggest the generality of carnitine palmitoyltransferase-1 inhibition under various stress conditions associated with ROS generation, providing an insight into a mechanism for oxidative dysfunction in mitochondrial metabolism. PMID:24118240
  28. The association of the arctic variant of CPT1A with infectious disease outcomes in children between birth and 2.5 years of age suggests that this variant may play a role in the historically high incidence PMID:23992672
  29. Exposure to all-trans RA (ATRA) up-regulated the expression of carnitine palmitoyl transferase-1 (CPT1-L) in HepG2 cells in a dose- and time-dependent manner. PMID:22871568
  30. we have identified CPT1A as a novel transcriptional target of PAX3-FKHR and revealed the novel function of CPT1A in promoting cell motility. PMID:22533991
  31. The CPT1A p.P479L variant is common to some coastal BC First Nations, and homozygosity for this variant is associated with unexpected death in infancy PMID:23090344
  32. Data suggest that CPT1A, leptin receptor (LEPR), and insulin receptor (INSR) mRNA levels are higher in blood cells/blood from overweight children compared with normal weight children; INSR and CPT1A are increased only in males. PMID:22278432
  33. Our findings are consistent with the hypothesis that the L479 allele of the CPT1A P479L variant confers a selective advantage that is both cardioprotective (through increased HDL-cholesterol) and associated with reduced adiposity PMID:22045927
  34. carrier frequency of the c.1364A>C mutation of cpt1a in Finland is far lower than that of the variants found in Alaskan, Canadian, and Greenland native populations. PMID:21962599
  35. Impaired fasting tolerance among Alaska native children with a common carnitine palmitoyltransferase 1A sequence variant. PMID:21763168
  36. an environment-dependent structural switch underlies the regulation of carnitine palmitoyltransferase 1A PMID:21990363
  37. significant correlation between strong expression of CPT1A protein and poor outcome of ESCC patients PMID:21484929
  38. These studies identified a favourable role for CPT1A in adipocytes to attenuate fatty acid-evoked insulin resistance and inflammation via suppression of JNK. PMID:21348853
  39. Data show PEPCK-C and CPT-1 mRNAs are more abundant in non-tumoral tissues than in the tumoral counterpart, whereas the opposite occurred for the FAS gene. PMID:20691246
  40. allele frequency and rate of homozygosity for the CPT1A P479L variant were high in Inuit and Inuvialuit who reside in northern coastal regions of Canada. PMID:20696606
  41. The CPT1A c.1436C-->T variant is prevalent among some Alaska Native peoples, but newborn screening using current MS/MS cutoffs is not an effective means to identify homozygous infants PMID:20843525
  42. Our data provide preliminary evidence that a highly prevalent CPT1A variant found among Alaska Native and other indigenous circumpolar populations may help explain historically high infant mortality rates. PMID:20937660
  43. PPARalpha and PGC-1alpha stimulate transcription of the CPT-1A gene through different regions of CPT-1A gene. PMID:20638986
  44. miR-370 acting via miR-122 may have a causative role in the accumulation of hepatic triglycerides by modulating initially the expression of SREBP-1c, DGAT2, and Cpt1alpha. PMID:20124555
  45. Mutations 1079A>G and 2028+2delAAGT result in an autosomal recessive mitochondrial fatty acid oxidation disorder. PMID:12111367
  46. hyperglycemia with hyperinsulinemia increases malonyl-CoA, inhibits functional CPT-1 activity, and shunts long-chain fatty acids away from oxidation and toward storage in human muscle PMID:12464674
  47. disease-causing CPT1A mutations can be divided into two categories depending on whether they affect directly or indirectly the active site of the enzyme PMID:14517221
  48. tBid decreases CPT-1 activity by a mechanism independent of both malonyl-CoA, the key inhibitory molecule of CPT-1, and Bak and/or Bax, but dependent on cardiolipin decrease PMID:15846373
  49. This inducible expression system should be well suited to study the roles of CPT1 and fatty acid oxidation in lipotoxicity and metabolism in vivo. PMID:16246309
  50. a conserved functional PPAR responsive element downstream of the transcriptional start site of the human CPT1A gene is localized; this sequence is fundamental for fatty acids or PGC1-induced transcriptional activation of the CPT1A gene PMID:16271724

Show More

Hide All

Subcellular Location
Mitochondrion outer membrane; Multi-pass membrane protein.
Protein Families
Carnitine/choline acetyltransferase family
Tissue Specificity
Strong expression in kidney and heart, and lower in liver and skeletal muscle.
Database Links

HGNC: 2328

UNIGENE: Hs.503043

KEGG: hsa:1374

STRING: 9606.ENSP00000265641

OMIM: 255120

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products