Recombinant Human Cannabinoid receptor 2 (CNR2)-VLPs

Code: CSB-MP005679HU
Size:
20ug
20ug100ug1mg
US$558
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CNR2 protein-VLPs
Purity
VLPs
Target Names
CNR2
Uniprot NO.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-360aa
Target Protein Sequence
MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.1 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
Gene References into Functions
  1. Among 1027 obese patients, genotypes GG, GA, and AA were found in 339 (33.0%), 467 (45.5%), and 221 (21.5%) respectively. Body mass index, weight, fat mass, waist circumference, insulin, HOMA-IR, and triglyceride and leptin levels were higher in A-allele carriers as compared to non A-allele carriers. No differences were seen in these parameters between the GA and AA genotypes. PMID:28895540
  2. in immune cells, activation of both CB2R variants 63Q and 63R causes phosphorylation of ERK; however, the signal intensity caused by 63R activation is relatively weaker than that caused by 63Q activation PMID:29694791
  3. The cannabinoid receptor type 2 (CB2) Q63R variation is associated with increased risk of hospitalization in children with acute respiratory tract infection (ARTI). Children carrying the QQ genotype are more prone to developing severe ARTI. The associated risk of developing severe ARTI following RSV infection increases in children carrying the Q allele PMID:28992427
  4. Urinary bladder cancer cell growth and motility implicate cannabinoid 2 receptor-mediated modifications of sphingolipids metabolism. PMID:28191815
  5. Study shows that this endogenous fatty acid ethanolamide affects cannabinoid signaling by upregulating cannabinoid receptor 2 expression in mononuclear phagocytic cells. PMID:28336953
  6. This study found enhanced CNR2 mRNA levels in all Low Back Pain participants. PMID:28481838
  7. Carriers of the minor allele of rs3123554 variant of CB2R gene loose less body weight during two different hypocaloric diets. The improvement of metabolic parameters was better in no A allele carriers than A allele carriers. PMID:29518488
  8. CB2 activation with sub-micromolar doses of agonists, which could be more similar to endogenous levels of cannabinoids, promote colon cancer progression in a process that involves AKT and GSK3beta. PMID:27634891
  9. stimulation of MAPK contributes to the peripheral analgesic effect of CB2 receptor agonists. PMID:26108183
  10. Describe PM226, a chromenoisoxazole, as a selective CB2 receptor agonist with neuroprotective properties. PMID:27013280
  11. Our data indicate that CB2 may directly contribute to the pathogenesis of eosinophil-driven diseases. Moreover, we provide new insights into the molecular mechanisms underlying the CB2 -mediated priming of eosinophils. PMID:26850094
  12. analysis of the interplay between the CB2-RR variant and liver necroinflammation in chronic hepatitis patients with HIV/HCV coinfection PMID:28759568
  13. Patients with schizophrenia showed increased CB2R expression in cells of the innate immune system and simpler correlation network between cytokines and CBRs expression when compared with controls. PMID:28011441
  14. Cannabinoid Receptor 2 mutation is associated with obesity. PMID:27294325
  15. The type 2 cannabinoid (Cnr2) receptor is implicated in cancer, bone metabolism and pain perception. Emerging data have uncovered the role of Cnr2 in the regulation of tumour-bone cell interactions and suggest that agents that target Cnr2 in the skeleton have potential efficacy in the reduction of skeletal complications associated with cancer. [review] PMID:28274851
  16. The prevalence of chronic HCV infected patients with the CB2-63 RR variant was significantly higher in the immune-mediated disorder (IMD) than in the non-IMD group. The data suggest a significant, previously unknown, independent association between the CB2-63 RR variant and IMDs in anti-HCV-positive patients. PMID:27476469
  17. CNR2 gene has an important role in the etiology of osteoporosis and suggest that it may be a genetic risk factor for BMD and osteoporosis in Han Chinese postmenopausal women. PMID:26055357
  18. A histological activity index (HAI) > 8 (Ishak scoring) was more frequent in patients with CB2-63 RR than in those with CB2-63 QR or QQ (37% vs. 16.7%, p < 0.05). PMID:25749560
  19. Study demonstrates the up-regulation of CB2 receptors in glial elements in postmortem tissues of Parkinson's disease patients and an inflammatory mouse model PMID:25863279
  20. Association between the CB2 Q63R functional variant and the age at menarche in obese girls. PMID:26447698
  21. CB2 receptor activation can attenuate HAND severity by inhibiting HIV replication, blunting HIV-triggered neuroinflammation, preventing HIV-induced damage to Blood-brain-barrier integrity, and preventing HIV-associated synapse loss. PMID:25015040
  22. Data show that HU308 and JWH133 enhanced human and mouse breast cancer cell-induced osteoclastogenesis and exacerbated osteolysis. PMID:26195631
  23. Targeting CB2 may represent an attractive approach to treat cancers of immune origin. PMID:25640641
  24. results suggest that rs2501431, rs3003336, rs2229579, and rs4237 polymorphisms in CNR2 genes may be genetic factors affecting bone mineral density in Korean postmenopausal women PMID:25268406
  25. no significant differences between preeclamptic and normal placenta in terms of CB2 and FAAH expressions and immunoreactivity PMID:25444073
  26. up-regulated expression of hCB2R could induce cell apoptosis by enhancing the expressions of Bax, Bad and suppressing the expression of Bcl-2 in Caski cells PMID:26062417
  27. data from this study suggested that activation of CB2 receptor plays important role in osteogenic differentiation of BM-MSCs. Lack of CB2 receptor may be related to osteoporosis. PMID:25685815
  28. Cannabinoid receptor type 2 contributes to susceptibility to oligo/polyarticular juvenile idiopathic arthritis and to the severity of its clinical course. PMID:25974389
  29. These pilot findings suggest that CB2 Q63R polymorphism does not play a major role in genetic susceptibility to inflammatory bowel disease or in its disease phenotypes among Turkish subjects PMID:25599774
  30. findings reveal an unprecedented role of CB2 as a pivotal regulator of HER2 pro-oncogenic signaling in breast cancer, and they suggest that CB2 may be a biomarker with prognostic value in these tumors. PMID:25855725
  31. The CB2-63 QQ variant in HCV patients was independently associated with the persistently normal alanine aminotransferase status. PMID:24940753
  32. The present study shows CB2 is expressed in human post-mortem striatum in Huntington's disease PMID:24978314
  33. Amino acids Valine113 and Leucine192 play important roles in ligand binding and downstream signaling transduction of the CB2 receptor. PMID:25148941
  34. CB2R and GPR55 form heteromers in cancer cells, these structures possess unique signaling properties, and modulation of these heteromers can modify the antitumoral activity of cannabinoids in vivo PMID:24942731
  35. Increased CB2 mRNA and anandamide in human blood after cessation of cannabis abuse PMID:24788457
  36. Activation of CB2 receptors reduces adhesion and transmigration of melanoma cells through the cerebral endothelium. PMID:24815068
  37. association of the minor allele of SNP rs3123554 within the CNR2 gene with lower BMI and body fat; significant association of the SNP with BMI was limited to females PMID:23839870
  38. CB2R activation drives an altered phenotype of foam cells, by negatively regulating lipid influx and/or by modulating cytokine profile PMID:24529123
  39. The mRNA level for cannabinoid receptor type 2 (CB2) was significantly increased in peripheral blood mononuclear cells from autistic children as compared to healthy subjects PMID:23585028
  40. applied a comprehensive G protein-coupled receptor-Galphai protein chemical cross-linking strategy to map the cannabinoid receptor subtype 2 (CB2)-Galphai interface and then used molecular dynamics simulations to explore the dynamics of complex formation PMID:24855641
  41. Data suggest that ligand binding to CNR2 (either recombinant or constitutive) is important to agonist action (and presumably antinociceptive action) of ligands (despite low signal obtained in native tissues/spleen). PMID:23711022
  42. The functional role of intracellular CB2 receptors has been defined and linked to calcium signaling. PMID:25033246
  43. The global fold of human cannabinoid type 2 (CB2 ) receptor in the agonist-bound active state in lipid bilayers was studied. PMID:23999926
  44. Antagonism of cannabinoid receptor 2 pathway suppresses IL-6-induced immunoglobulin IgM secretion. PMID:24913620
  45. cultures of hMSCs express all of the components of the endocannabinoid system and suggest a potential role for the cannabinoid CB2 receptor as a mediator of MSC anti-inflammatory properties, as well as for their survival pathways. PMID:24312195
  46. The CB2-63 QQ variant of CNR2 is associated with more severe inflammation and hepatocellular necrosis in patients with HCV infection. PMID:23707465
  47. CB2 receptor expression in proximal tubule cells is modulated by internalization of albumin. PMID:24280624
  48. Report synthesis of carbazole derived CB(2) ligands/agonists with increased polarity. PMID:24243315
  49. In rheumatoid arthritis patients' synovial fibroblasts, proinflammatory mediators up-regulate the expression of cannabinoid receptor 2, which negatively regulates the production of proinflammatory cytokines and matrix metalloproteinases. PMID:24440992
  50. selective CB2 activation in leukocytes decreases key steps in monocyte-blood-brain barrier engagement. PMID:24055259

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spl
Database Links

HGNC: 2160

UNIGENE: Hs.73037

KEGG: hsa:1269

STRING: 9606.ENSP00000363596

OMIM: 605051

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products