MEECWVTEIANGSKDGLDSNPMKDYMILSGPQKTAVAVLCTLLGLLSALENVAVLYLILSSHQLRRKPSYLFIGSLAGADFLASVVFACSFVNFHVFHGVDSKAVFLLKIGSVTMTFTASVGSLLLTAIDRYLCLRYPPSYKALLTRGRALVTLGIMWVLSALVSYLPLMGWTCCPRPCSELFPLIPNDYLLSWLLFIAFLFSGIIYTYGHVLWKAHQHVASLSGHQDRQVPGMARMRLDVRLAKTLGLVLAVLLICWFPVLALMAHSLATTLSDQVKKAFAFCSMLCLINSMVNPVIYALRSGEIRSSAHHCLAHWKKCVRGLGSEAKEEAPRSSVTETEADGKITPWPDSRDLDLSDC
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.1 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃.
Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing
Heterotrimeric G protein-coupled receptor for endocannabinoid 2-arachidonoylglycerol mediating inhibition of adenylate cyclase. May function in inflammatory response, nociceptive transmission and bone homeostasis.
Gene References into Functions
Among 1027 obese patients, genotypes GG, GA, and AA were found in 339 (33.0%), 467 (45.5%), and 221 (21.5%) respectively. Body mass index, weight, fat mass, waist circumference, insulin, HOMA-IR, and triglyceride and leptin levels were higher in A-allele carriers as compared to non A-allele carriers. No differences were seen in these parameters between the GA and AA genotypes.PMID:28895540
in immune cells, activation of both CB2R variants 63Q and 63R causes phosphorylation of ERK; however, the signal intensity caused by 63R activation is relatively weaker than that caused by 63Q activationPMID:29694791
The cannabinoid receptor type 2 (CB2) Q63R variation is associated with increased risk of hospitalization in children with acute respiratory tract infection (ARTI). Children carrying the QQ genotype are more prone to developing severe ARTI. The associated risk of developing severe ARTI following RSV infection increases in children carrying the Q allelePMID:28992427
Urinary bladder cancer cell growth and motility implicate cannabinoid 2 receptor-mediated modifications of sphingolipids metabolism.PMID:28191815
Study shows that this endogenous fatty acid ethanolamide affects cannabinoid signaling by upregulating cannabinoid receptor 2 expression in mononuclear phagocytic cells.PMID:28336953
This study found enhanced CNR2 mRNA levels in all Low Back Pain participants.PMID:28481838
Carriers of the minor allele of rs3123554 variant of CB2R gene loose less body weight during two different hypocaloric diets. The improvement of metabolic parameters was better in no A allele carriers than A allele carriers.PMID:29518488
CB2 activation with sub-micromolar doses of agonists, which could be more similar to endogenous levels of cannabinoids, promote colon cancer progression in a process that involves AKT and GSK3beta.PMID:27634891
stimulation of MAPK contributes to the peripheral analgesic effect of CB2 receptor agonists.PMID:26108183
Describe PM226, a chromenoisoxazole, as a selective CB2 receptor agonist with neuroprotective properties.PMID:27013280
Our data indicate that CB2 may directly contribute to the pathogenesis of eosinophil-driven diseases. Moreover, we provide new insights into the molecular mechanisms underlying the CB2 -mediated priming of eosinophils.PMID:26850094
analysis of the interplay between the CB2-RR variant and liver necroinflammation in chronic hepatitis patients with HIV/HCV coinfectionPMID:28759568
Patients with schizophrenia showed increased CB2R expression in cells of the innate immune system and simpler correlation network between cytokines and CBRs expression when compared with controls.PMID:28011441
Cannabinoid Receptor 2 mutation is associated with obesity.PMID:27294325
The type 2 cannabinoid (Cnr2) receptor is implicated in cancer, bone metabolism and pain perception. Emerging data have uncovered the role of Cnr2 in the regulation of tumour-bone cell interactions and suggest that agents that target Cnr2 in the skeleton have potential efficacy in the reduction of skeletal complications associated with cancer. [review]PMID:28274851
The prevalence of chronic HCV infected patients with the CB2-63 RR variant was significantly higher in the immune-mediated disorder (IMD) than in the non-IMD group. The data suggest a significant, previously unknown, independent association between the CB2-63 RR variant and IMDs in anti-HCV-positive patients.PMID:27476469
CNR2 gene has an important role in the etiology of osteoporosis and suggest that it may be a genetic risk factor for BMD and osteoporosis in Han Chinese postmenopausal women.PMID:26055357
A histological activity index (HAI) > 8 (Ishak scoring) was more frequent in patients with CB2-63 RR than in those with CB2-63 QR or QQ (37% vs. 16.7%, p < 0.05).PMID:25749560
Study demonstrates the up-regulation of CB2 receptors in glial elements in postmortem tissues of Parkinson's disease patients and an inflammatory mouse modelPMID:25863279
Association between the CB2 Q63R functional variant and the age at menarche in obese girls.PMID:26447698
CB2 receptor activation can attenuate HAND severity by inhibiting HIV replication, blunting HIV-triggered neuroinflammation, preventing HIV-induced damage to Blood-brain-barrier integrity, and preventing HIV-associated synapse loss.PMID:25015040
Data show that HU308 and JWH133 enhanced human and mouse breast cancer cell-induced osteoclastogenesis and exacerbated osteolysis.PMID:26195631
Targeting CB2 may represent an attractive approach to treat cancers of immune origin.PMID:25640641
results suggest that rs2501431, rs3003336, rs2229579, and rs4237 polymorphisms in CNR2 genes may be genetic factors affecting bone mineral density in Korean postmenopausal womenPMID:25268406
no significant differences between preeclamptic and normal placenta in terms of CB2 and FAAH expressions and immunoreactivityPMID:25444073
up-regulated expression of hCB2R could induce cell apoptosis by enhancing the expressions of Bax, Bad and suppressing the expression of Bcl-2 in Caski cellsPMID:26062417
data from this study suggested that activation of CB2 receptor plays important role in osteogenic differentiation of BM-MSCs. Lack of CB2 receptor may be related to osteoporosis.PMID:25685815
Cannabinoid receptor type 2 contributes to susceptibility to oligo/polyarticular juvenile idiopathic arthritis and to the severity of its clinical course.PMID:25974389
These pilot findings suggest that CB2 Q63R polymorphism does not play a major role in genetic susceptibility to inflammatory bowel disease or in its disease phenotypes among Turkish subjectsPMID:25599774
findings reveal an unprecedented role of CB2 as a pivotal regulator of HER2 pro-oncogenic signaling in breast cancer, and they suggest that CB2 may be a biomarker with prognostic value in these tumors.PMID:25855725
The CB2-63 QQ variant in HCV patients was independently associated with the persistently normal alanine aminotransferase status.PMID:24940753
The present study shows CB2 is expressed in human post-mortem striatum in Huntington's diseasePMID:24978314
Amino acids Valine113 and Leucine192 play important roles in ligand binding and downstream signaling transduction of the CB2 receptor.PMID:25148941
CB2R and GPR55 form heteromers in cancer cells, these structures possess unique signaling properties, and modulation of these heteromers can modify the antitumoral activity of cannabinoids in vivoPMID:24942731
Increased CB2 mRNA and anandamide in human blood after cessation of cannabis abusePMID:24788457
Activation of CB2 receptors reduces adhesion and transmigration of melanoma cells through the cerebral endothelium.PMID:24815068
association of the minor allele of SNP rs3123554 within the CNR2 gene with lower BMI and body fat; significant association of the SNP with BMI was limited to femalesPMID:23839870
CB2R activation drives an altered phenotype of foam cells, by negatively regulating lipid influx and/or by modulating cytokine profilePMID:24529123
The mRNA level for cannabinoid receptor type 2 (CB2) was significantly increased in peripheral blood mononuclear cells from autistic children as compared to healthy subjectsPMID:23585028
applied a comprehensive G protein-coupled receptor-Galphai protein chemical cross-linking strategy to map the cannabinoid receptor subtype 2 (CB2)-Galphai interface and then used molecular dynamics simulations to explore the dynamics of complex formationPMID:24855641
Data suggest that ligand binding to CNR2 (either recombinant or constitutive) is important to agonist action (and presumably antinociceptive action) of ligands (despite low signal obtained in native tissues/spleen).PMID:23711022
The functional role of intracellular CB2 receptors has been defined and linked to calcium signaling.PMID:25033246
The global fold of human cannabinoid type 2 (CB2 ) receptor in the agonist-bound active state in lipid bilayers was studied.PMID:23999926
cultures of hMSCs express all of the components of the endocannabinoid system and suggest a potential role for the cannabinoid CB2 receptor as a mediator of MSC anti-inflammatory properties, as well as for their survival pathways.PMID:24312195
The CB2-63 QQ variant of CNR2 is associated with more severe inflammation and hepatocellular necrosis in patients with HCV infection.PMID:23707465
CB2 receptor expression in proximal tubule cells is modulated by internalization of albumin.PMID:24280624
Report synthesis of carbazole derived CB(2) ligands/agonists with increased polarity.PMID:24243315
In rheumatoid arthritis patients' synovial fibroblasts, proinflammatory mediators up-regulate the expression of cannabinoid receptor 2, which negatively regulates the production of proinflammatory cytokines and matrix metalloproteinases.PMID:24440992
selective CB2 activation in leukocytes decreases key steps in monocyte-blood-brain barrier engagement.PMID:24055259
Preferentially expressed in cells of the immune system with higher expression in B-cells and NK cells (at protein level). Expressed in skin in suprabasal layers and hair follicles (at protein level). Highly expressed in tonsil and to a lower extent in spl