AFSNQTYPTIEPKPFLYVVGRKKMMDAQYKCYDRMQQLPAYQGEGPYCNRTWDGWLCWDD TPAGVLSYQFCPDYFPDFDPSEKVTKYCDEKGVWFKHPENNRTWSNYTMCNAFTPEKLKN AYVLYYLAIVGHSLSIFTLVISLGIFVFFRKLTTIFPLNWKYRKALSLGCQRVTLHKNMF LTYILNSMIIIIHLVEVVPNGELVRRDPVSCKILHFFHQYMMACNYFWMLCEGIYLHTLI VVAVFTEKQRLRWYYLLGWGFPLVPTTIHAITRAVYFNDNCWLSVETHLLYIIHGPVMAA LVVNFFFLLNIVRVLVTKMRETHEAESHMYLKAVKATMILVPLLGIQFVVFPWRPSNKML GKIYDYVMHSLIHFQGFFVATIYCFCNNEVQTTVKRQWAQFKIQWNQRWGRRPSNRSARA AAAAAEAGDIPIYICHQEPRNEPANNQGEESAEIIPLNIIEQESSA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This is a receptor for calcitonin. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. The calcitonin receptor is thought to couple to the heterotrimeric guanosine triphosphate-binding protein that is sensitive to cholera toxin.; Receptor for calcitonin but is unable to couple to G proteins and activate adenylyl cyclase. Does not undergo receptor internalization following ligand binding.
Gene References into Functions
CTR activates AKAP2-anchored cAMP-dependent protein kinase A, which then phosphorylates tight junction proteins ZO-1 and claudin 3.PMID:28428082
structure of a full-length class B receptor, the calcitonin receptor, in complex with peptide ligand and heterotrimeric Galphasbetagamma protein determined by Volta phase-plate single-particle cryo-electron microscopyPMID:28437792
Data suggest that a single GlcNAc residue at CTR N130 (asparagine 130) is responsible for enhanced affinity of calcitonin for CTR ECD; the same appears to apply for enhanced affinity of amylin for RAMP2-CTR ECD. [GlcNAc = N-acetylglucosamine; CTR = calcitonin receptor; ECD = extracellular domain; RAMP2 = receptor (calcitonin) activity modifying protein 2].PMID:28614667
Males with CALCR TT genotype (rs1801197) have 13 fold increased risk for kidney stone disease. No significant association of rs1042138 with kidney stone in West Bengal, India.PMID:28435134
Calcitonin and Amylin Receptor Peptide Interaction Mechanisms: INSIGHTS INTO PEPTIDE-BINDING MODES AND ALLOSTERIC MODULATION OF THE CALCITONIN RECEPTOR BY RECEPTOR ACTIVITY-MODIFYING PROTEINS.PMID:26895962
An association between fluorosis and the Alu I polymorphism in the CTR gene was observed in fluoride-exposed populations.PMID:25402775
The C1377T polymorphism in the CTR gene is associated with bone mineral density at the lumbar spine in a postmenopausal Han Chinese populationPMID:25055932
There was no statistically significant difference in CTR gene nucleotide sequence polymorphisms at 1377-bp between Chinese Xinjiang Han and Uygur patients with primary osteoporosis.PMID:24522475
Data indicate a potential association between 3'UTR+18C>T and intron 1 polymorphisms in the CALCR and the risk of kidney stone disease.PMID:24296906
Prolonged calcitonin receptor signaling by salmon, but not human calcitonin, reveals ligand bias.PMID:24643196
High calcitonin receptor is associated with prostate cancer.PMID:23820954
CTR was expressed by glioma cells in a majority of GBM tumours tested.PMID:22335784
Allele C in CALCR gene was associated with reduced bone mass in cystic fibrosis children.PMID:21462477
highly expressed on normal T- and B-lymphocytesPMID:19445988
Activation of calcitonin receptor and calcitonin receptor-like receptor by membrane-anchored ligands.PMID:19903822
relationship between calcitonin receptor (CTR) genotype and buccal marginal bone loss observed at stage II surgery for endosseous implantsPMID:11858573
an important role for filamin in the endocytic sorting and recycling of the internalized CTRPMID:12531889
Co-expression of calcitonin receptors (CT) lacking a portion of domain 1 with receptor activity-modifying protein (RAMP) 1, 2, or 3 appears to produce functional CT-(8-32)-sensitive adrenomedullin receptors.PMID:12565884
ALUI calcitonin receptor polymorphism genotype showed a positive association with prevalence of osteoporosis in the subjectsPMID:12771454
analysis of the amino terminus of the calcitonin receptor and its effects on docking constraintsPMID:14583624
the site of attachment of a photoaffinity label was identified as residue Leu(348) within the third extracellular loop of the receptorPMID:15155765
existence of two novel splice variants of human CTR and splicing patterns could be involved in the post-transcriptional regulation of the gene.PMID:15563840
Effects of VDR (Fok-I) and CTR gene polymorphism contribute to understanding of pathogenesis of urinary calculi. Potential candidate gene in search for genetic causes of paediatric calcium oxalate nephrolithiasis.PMID:15856322
normal cell surface expression, mobilization of intracellular calcium, and Erk activation requires the cytoplasmic C-terminal tail of the CTRPMID:15860547
The calcitonin receptor model is consistent with cooperative interaction between the receptor amino terminus and the receptor core.PMID:15929987
the MCP-1-induced TRAP(+)/CTR(+) multinuclear cells represent an arrested stage in osteoclast differentiation, after NFATc1 induction and cellular fusion but prior to the development of bone resorption activityPMID:16280328
up-regulation of CT biosynthesis and activation of CT-CTR axis in primary prostate tumors may have direct relevance in their progression to the metastatic phenotype.PMID:17487556
Study data suggest that the AluI polymorphism of the CTR gene can be useful as a genetic marker in the interindividual susceptibility of QUS parameters by the interaction with nutritional status as a lifestyle factor.PMID:17709929
High calcitonin receptor is associated with multiple myelomaPMID:17714780
BsmI and AluI polymorphisms are not related to the forearm bone values either reflecting mass or geometrical variables in this male population.PMID:18622089
the juxtamembranous region of the amino terminus of the family B G protein-coupled calcitonin receptor plays a critical role in small-molecule agonist actionPMID:19447889