Recombinant Human CD99 antigen (CD99)

Code: CSB-CF004973HU
Size:
20μg
20μg100μg
US$3714
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CD99
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
23-185
Target Protein Sequence
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Involved in T-cell adhesion processes and in spontaneous rosette formation with erythrocytes. Plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane. Acts at the same site as, but independently of, PECAM1. Involved in T-cell adhesion processes.
Gene References into Functions
  1. Besides confirming the importance of CD99, findings indicate that polymorphic variations in this gene may affect either development or progression of EWS. PMID:27792997
  2. CD99 is a marker of acute myeloid leukemia and myelodysplastic syndrome stem cells PMID:28123069
  3. CD99 expression is increased in patients with active Inflammatory bowel disease, and positively correlated with disease activity. PMID:27866429
  4. CD99 counteracts EWS-FLI1 in controlling NF-kappaB signaling through the miR-34a, which is increased and secreted into exosomes released by CD99-silenced Ewing sarcoma cells. PMID:26616853
  5. these observations suggest that CD99 is involved in the regulation of CD1a transcription and expression by increasing ATF-2. PMID:27094031
  6. CD99 was also paranuclear positive in 4 of 11 (36%) small cell lung carcinomas PMID:26782152
  7. High expression of EMMPRIN plays a crucial role in breast cancer cell proliferation, matrigel invasion and tumor formation. PMID:27002769
  8. Data show that CD99 antigen expression increased during in vitro differentiation of germinal center B cells and was highest in plasma cells (PCs). PMID:26522646
  9. Our results suggest that the CD34/CD25/CD123/CD99(+) LAIP is strictly associated with FLT3-ITD-positive cells. PMID:25957287
  10. The results highlight an important role of CD99 in the differentiation and activity of human osteoblasts in physiological and pathological conditions. PMID:26000312
  11. CD99 can suppress CD98-mediated assembly of pro-tumorigenic signaling complexes through its ability to dephosphorylate focal adhesion kinase. PMID:26172215
  12. CD99 expression in astrocytomas of different malignant grades might contribute to the infiltrative ability and support the importance of CD99 as a potential target to reduce infiltrative astrocytoma capacity in migration and invasion. PMID:24797829
  13. The dAbd C7 induced rapid and massive EWS cell death through Mdm2 degradation and p53 reactivation. Mdm2 overexpression as well as silencing of p53 in p53wt EWS cells decreased CD99-induced EWS cell death PMID:25501132
  14. CD99 expression in nasal lobular capillary haemangioma. PMID:24702676
  15. dermatofibromastrongly expresses CD99 in a diffuse pattern that may serve as evidence in distinction from dermatofibrosarcoma PMID:24247571
  16. CD99 induces ERK activation, increasing its membrane-bound/cytoplasmic form rather than affecting its nuclear localization. PMID:24677094
  17. The new antibody scFvC7 recognizes the CD99 extracellular domain. PMID:22335486
  18. Report purification of human antibody scFv anti-CD99 for blocking monocyte transendothelial migration. PMID:24798881
  19. Solid pseudopapillary neoplasm of the pancreas exhibits a very unique immunostaining pattern for CD99 that is present in all cases. PMID:24094957
  20. we have shown that forced expression of wild-type CD99 in osteosarcoma cells induces downregulation of genes such as ROCK2 PMID:23644663
  21. CXCL16, inversely correlated with CD99 expression in Hodgkin Reed-Sternberg (H/RS) cells. PMID:23743627
  22. It is assumed that the expression of CD99 plays an important role in the pathogenesis of psoriasis, in the processes of emigration of leukocytes, and in their tropism toward to the epidermis PMID:24341229
  23. we show that miR-30a-5p provides an essential link between EWS-FLI1 and CD99, two major biomarkers in Ewing sarcoma PMID:22986530
  24. CD99 is highly expressed in anaplastic large-cell lymphoma, and showed high rate of co-expression with ALK. PMID:22781601
  25. PVR resides in the recently identified lateral border recycling compartment, similar to PECAM and CD99. PMID:23333754
  26. We report an unusual pattern of paranuclear dot-like expression of CD99 in 14 cases of Merkel cell carcinoma, two of which did not express CK20. PMID:23145531
  27. CD99-induced HSP70 expression in B and T lymphocytes. PMID:23152061
  28. Data suggest that CD99 expression in lymph node/germinal center biopsies at time of diagnosis is not prognostic marker for survival in patients with diffuse large B-cell lymphoma treated with rituximab-CHOP immunochemotherapy. PMID:22864685
  29. the membrane protein CD99 was identified as a novel stromal factor with clinical relevance. The results support the concept that stromal properties have an important impact on tumour progression. PMID:22392539
  30. upregulation of CD99 in H/RS cells induces terminal B-cell differentiation, which may provide a novel therapeutic strategies for cHL PMID:22020966
  31. Platelet endothelial cell adhesion molecule-1 (PECAM-1/CD31) and CD99 are critical in lymphatic transmigration of human dendritic cells. PMID:22189791
  32. NF-kappaB2 exhibits the major inhibitory role in the transcription at the CD99 promoter PMID:22083306
  33. High CD99 is associated with central primitive neuroectodermal tumors and Ewing's sarcoma PMID:21267687
  34. Data show that CD99 combined with E-cadherin/beta-catenin and CD10 can be used as a relatively specific expression profile of SPTs. PMID:21775056
  35. Our study has identified for the first time that pancreatic solid-pseudopapillary neoplasm exhibits a unique dot-like staining pattern for CD99. PMID:21566515
  36. CD99 positivity was significantly associated with advanced stage (p < 0.01), higher risk group according to the International Prognostic Index risk score (p < 0.01) and non-germinal center B cell-like type (p = 0.01). PMID:21196719
  37. Protein expression and gene promoter hypermethylation of CD99 in transitional cell carcinoma of urinary bladder PMID:20217126
  38. CD99 showed no preferential staining of Atypical fibroxanthoma, spindle cell malignant melanoma or sarcomatoid carcinoma/spindle cell squamous cell carcinoma PMID:20184665
  39. CD99 may play a physiologic role in the clonal deletion processes necessary for B-lymphoid selection PMID:20453109
  40. Analysis of a panel of human EWS cells revealed an inverse correlation between CD99 and H-neurofilament expression, as well as an inverse correlation between neural differentiation and oncogenic transformation. PMID:20197622
  41. Results suggest that type I is the major isoform of CD99 expressed in non-neoplastic gastric mucosa and gastric adenocarcinomas. PMID:12172043
  42. Functional involvement of src and focal adhesion kinase in a CD99 splice variant-induced motility of human breast cancer cells PMID:12216109
  43. engagement triggers the exocytic transport of ganglioside GM1 and the reorganization of actin cytoskeleton PMID:12681511
  44. inhibition by MHC class I engagement or apoptosis and upregulation of T cell receptor and MHC molecules in human thymocytes and T cell line induced by CD99 PMID:12832073
  45. CD99 epitopes plays a distinct role in T cell biology, especially in T cell apoptosis. PMID:14623115
  46. CD99 type II acts as a negative regulator in the neural differentiation of precursor cells that might occur during nerve system development PMID:14646598
  47. Solitary sclerotic fibroma is a fibrotic lesion with cells positive for CD34 and O13. O13 expression in SF has not been previously described. PMID:14744088
  48. our findings indicate that CD99 functions occur through reorganization of cytoskeleton and identify actin and zyxin as the early signaling events driven by CD99 engagement. PMID:15184883
  49. solution structure of cytoplasmic domain of human CD99 type I shows that it has a hairpin shape anchored by two flexible loops PMID:15359120
  50. cyclophilin A binds CD99 and may be either a signaling mediator or a signaling regulator for CD99 PMID:15388255

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
CD99 family
Database Links

HGNC: 7082

UNIGENE: Hs.653349

KEGG: hsa:4267

STRING: 9606.ENSP00000370588

OMIM: 313470

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products