SSFAILMAHYDVEDWKLTLITRVGLALSLFCLLLCILTFLLVRPIQGSRTTIHLHLCICL FVGSTIFLAGIENEGGQVGLRCRLVAGLLHYCFLAAFCWMSLEGLELYFLVVRVFQGQGL STRWLCLIGYGVPLLIVGVSAAIYSKGYGRPRYCWLDFEQGFLWSFLGPVTFIILCNAVI FVTTVWKLTQKFSEINPDMKKLKKARALTITAIAQLFLLGCTWVFGLFIFDDRSLVLTYV FTILNCLQGAFLYLLHCLLNKKVREEYRKWACLVAGGSKYSEFTSTTSGTGHNQTRALRA SESGI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8
Receptor potentially involved in both adhesion and signaling processes early after leukocyte activation. Plays an essential role in leukocyte migration.
Gene References into Functions
Biochemical features of the adhesion G protein-coupled receptor CD97 related to its auto-proteolysis and HeLa cell attachment activitiesPMID:27641734
High CD97 expression Correlates with Breast, Colorectal and Pancreatic Cancer.PMID:28373465
High expression of CD97 is associated with lymphatic metastasis in gastric cancer.PMID:26233326
This study indicated that the CD97 and CD55 proteins might be reliable biomarkers to predict the metastasis status and prognosis of intrahepatic cholangiocarcinoma patients.PMID:28345461
Knock down of CD97 led to an altered mechanical phenotype, reduced adhesion to a stromal layer and lower wildtype FLT3 expression.PMID:26462154
present study suggested that the expressions of CD97 antigen and decay accelerating factor(DAF) were both upregulated in human cervical squamous cell carcinomaPMID:26107567
CD97 promotes gastric cancer cell proliferation and invasion in vitro through exosome-mediated MAPK signaling pathway, and exosomal miRNAs are probably involved in activation of the CD97-associated pathway.PMID:26034356
we identify the specific isoforms of CD97, a novel pro-invasive glioma antigen, across histologic grades of glioma and within BTICs. We also demonstrate a trend towards increased CD97 expression among the classical and mesenchymal GBM subtypes.PMID:25714433
We conclude that CD97 is located in the SR and at the peripheral sarcolemma of human and murine skeletal muscle, where its absence affects the structure of the SR without impairing skeletal muscle functionPMID:24949957
CD97 enhanced TIMP-2 secretion, leading to reduced MT-MMP-1 and -2 activities, impairing cell migration/invasion in vitro and lung macrometastasis in vivo and upregulating integrins. Both the NTF and the CTF of CD97 were required.PMID:25174588
These results provide the first experimental evidence that cd97 is a direct target of miR-126.PMID:24274104
study reports gene expression in skeletal muscle tissue of women with metabolic syndrome is enriched in inflammatory response-related genes; IL6R, HDAC9 and CD97 expression correlated negatively with insulin sensitivity; suggests a role for these 3 inflammatory genes in development of skeletal muscle insulin resistance in womenPMID:23771909
Lysophosphatidylethanolamine utilizes LPA(1) and CD97 in a breast cancer cell line.PMID:23838008
CD97 expression promotes invasion and migration in glioblastoma multiforme, but has no effect on tumor proliferation.PMID:23658650
CD97 expression in human thyroid cancers correlated with LPA receptor and markers of aggressiveness including Ki67 and pAKT.PMID:22797060
CD97 small isoform not only supported gastric cancer local growth, but also promoted metastatic spread in orthotopically implanted mouse model.PMID:22768192
CD97 and CD55 showed high expression at the invasive front of gallbladder carcinoma. CD97 and CD55 expression was associated with high histologic grade, advanced pathologic T stage, clinical stage and positive venous/lymphatic invasion.PMID:22547928
binding of leukocytes to activated endothelium mediated by the interaction of CD97 with Thy-1 is involved in firm adhesion of polymorphonuclear cells during inflammation and may play a role in the regulation of leukocyte trafficking to inflammatory sites.PMID:22210915
we conclude that the possible upregulation of CD97 mediated by WT1 promotes cellular invasiveness-one of the most characteristic and challenging aspects of glial tumor cells.PMID:22313360
CD97 functioned to mediate invasion in prostate cancer cells, by associating with lysophosphatidic acid receptor 1 (LPAR1), leading to enhanced LPA-dependent RHO and extracellular signal-regulated kinase activation.PMID:21978933
expression of the wild type - but not the GPS cleavage-deficient CD97 up-regulates the expression of N-cadherin, leading to Ca(++)-dependent cell-cell aggregation.PMID:21156175
Elevated expression of CD97 and its ligand CD55 at the invasion front correlate with tumor recurrence and metastasis, and CD95 may be a poor prognostic factor for rectal adenocarcinoma.PMID:20339853
the tumor promoting role of CD97 small isoform in cancer progressionPMID:20428763
complex cellular expression programmes rather than activation modes regulate the expression of EGF-TM7 receptors in macrophagesPMID:20167235
CD97 expression correlates with dedifferentiation, migration, and invasion in colorectal tumor cell linesPMID:12414513
coengagement of alpha5beta1 and chondroitotin sulfate proteoglycan by CD97 synergistically initiates endothelial cell invasionPMID:15576472
Findings suggest that CD97(EGF) may play a role in the development and invasion of gastric carcinomas.PMID:16273233
CD55 engagement with its natural ligand CD97 can act as a potent costimulator of human CD4+ T cells, resulting in cellular activation and promoting enhanced proliferation and cytokine secretion.PMID:16818763
enhanced CD97 expression in colorectal cancer cells is regulated independent of beta-catenin/Tcf-4, and is thus not a direct target of the canonical Wnt pathwayPMID:16929497
CD55 may simultaneously regulate both the innate and adaptive immune responses and can also regulate complement when bound to CD97.PMID:17449467
EGF-TM7 pre-mRNAs also undergo the rare trans-splicing, leading to the generation of functional chimeric receptors.PMID:18267122
Sp1 and Sp3 over-expression activates CD97 promoter activity in HEK293 cells.PMID:18329191
CD97 is present on all lymphocytes in blood and lymphoid tissue. Expression of CD97 on B cells was lower compared to T and NK cells and did not differ between B-cell subsets.PMID:19428565
CD97-mFc can adopt two different conformations; one capable of auto-proteolysis and the other not.PMID:19737555
CD97 is expressed in all types of macrophages and dendritic cells except for microglia, in most T cells but only a few B cells, in smooth muscle cells, and in a restricted set of thyroid and gastrointestinal carcinomas.PMID:11380941
Broadly expressed, found on most hematopoietic cells, including activated lymphocytes, monocytes, macrophages, dendritic cells, and granulocytes. Expressed also abundantly by smooth muscle cells. Expressed in thyroid, colorectal, gastric, esophageal and p