CD83; CD83 antigen; hCD83; B-cell activation protein; Cell surface protein HB15; CD antigen CD83
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
20-205
Target Protein Sequence
TPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQKGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
May play a significant role in antigen presentation or the cellular interactions that follow lymphocyte activation.
Gene References into Functions
the presence of CD83 in mDC membranes enhances T lymphocyte proliferation by boosting calcium release from intracellular stores in these cells.PMID:24436459
this study shows that the tolerogenic mechanism of action of sCD83 to be dependent on initial interaction with antigen-presenting cells, altering early cytokine signal pathways and leading to T cell unresponsivenessPMID:28193829
this study shows differential expression and function of CD83 on human immune cells, and reveals potential new roles for this molecule as a target of therapeutic manipulation in transplantation, inflammation, and autoimmune diseasesPMID:27837105
We conducted a genome-wide association study (GWAS) of plasma caffeine, paraxanthine, theophylline, theobromine and paraxanthine/caffeine ratio. A single SNP at 6p23 (near CD83) and several SNPs at 7p21 (near AHR), 15q24 (near CYP1A2) and 19q13.2 (near CYP2A6) met GW-significance (P < 5 x 10-8) and were associated with one or more metabolitesPMID:27702941
Crystal structure of human CD83 reveals that its surface domain consists of an Ig-like domain only.CD83 exerts its immunological activity by mixed homotypic and heterotypic interactions as typically observed for proteins present in the immunological synapse.PMID:28315353
this study shows that dendritic cells from rheumatoid arthritis patients have low expression levels of CD83PMID:27421624
Triple costimulation via CD80, 4-1BB, and CD83 ligand elicits the long-term growth of Vgamma9Vdelta2 T cells in low levels of IL-2.PMID:26561569
nonspreading Rift Valley fever virus infection of monocyte-derived immature denditic cells results in incomplete maturation, associated with gradual downregulation of CD83.PMID:26575844
Sustained expression of CD83 was observed when CD4+ T cells were induced by transforming growth factor-beta to differentiate into CD4+CD25+ forkhead box P3+ regulatory T (iTreg) cells.PMID:25997495
These results suggest that HTLV-I induces CD83 expression on T cells via Tax1 -mediated NF-kappaB activation, which may promote HTLV-I infection in vivo.PMID:26129803
CD83(+) T cells share important features with regulatory T cells, identifying CD83 as a novel lineage marker to discriminate between different T cell populations.PMID:25151500
GRASP55 interacts with CD83 shortly after induction of dendritic cells maturation and that this interaction plays a role in CD83 glycosylation as well as in surface expression of CD83 on dendritic cells.PMID:25701785
suggesting that a negative feedback regulation may exist in monocyte differentiation into dendritic cells (DCs) based on sCD83 released from the mature DCsPMID:25243645
IDO and CD83 are expressed differently in human epidermal Langerhans cellsPMID:24268989
HSV-1 ICP0 alone induces CD83 degradation independent of its E3 ubiquitin ligase function and of the ubiquitin machinery.PMID:24643878
Data indicate that the frequencies of CD11c, CD11c/CD86, HLA-DR/CD86, CD83 and CD80 were significantly high, while CD11c/HLA-DR was low in Hepatitis E infection.PMID:23246582
We identified IRF-1, IRF-2, IRF-5, p50, p65, and cRel to be involved in regulating maturation-specific CD83 expression in DCs.PMID:23339870
Results do not suggest that the common genetic variation of CD83 is related to cervical or vulvar cancers. The association between tagSNP rs853360 and risk of cervical SCC is likely to be due to chance.PMID:22134374
CD83-stimulated monocytes suppress T-cell immune responses through production of prostaglandin E2PMID:22065790
Suggest that impaired immune function, absence of CD83-positive mature and activated dendritic cells in cancer nodules may have a role in the pathogenesis of thyroid papillary carcinoma.PMID:21469977
No CD83-positive Langerhans cells were detected in any epidermodysplasia verruciformis patients or normal controls.PMID:19317050
Human solublee CD83 alone is capable of inducing kidney allograft tolerance in kidney transplantation in mice.PMID:21076370
Structure identification of recombinant CD83 mutant variant as a potent therapeutic protein is reported.PMID:20566323
sCD83 is capable of attenuating dendritic cell maturation and function, and inducing donor-specific allograft tolerance, in the absence of toxicity.PMID:20861805
Data show that pollen grains triggered the production of IL-8, TNF-alpha, IL-6 and strongly upregulated the membrane expression of CD80, CD86, CD83, HLA-DR and caused only a slight increase in the expression of CD40.PMID:20118277
Data show high expression of CD86 and CD11C, moderate expression of CD1a and CD123, low levels of CD83 on dendritic cells after induction by GM-CSF and IL-4.PMID:19257981
the soluble extracellular CD83 domain inhibits DC-mediated T-cell proliferation, representing the first report describing a functional role for CD83.PMID:12072358
cloning and characterization of the promoter region of the human CD83 genePMID:12182451
Increased expression of DC-SIGN+IL-12+IL-18+ and CD83+IL-12-IL-18- dendritic cell populations in the colonic mucosa of patients with Crohn's diseasePMID:12594843
induction of the CD83 promoter by LMP1 of Epstein-barr virus is mediated by the activation of NF-kappaB signal pathway in B cellsPMID:12857898
20% of chronic lymphocytic leukemia & 5/7 mantle-cell lymphoma patients have significantly elevated levels of soluble CD83. sCD83 may have an immunoregulatory role in vivo & functional significance in hematological malignancies, like CLL and MCL.PMID:14687618
infected mature monocyte-derived dendritic cells lose surface CD83 while maintaining intracellular protein expression in cytomegalovirus infection.PMID:14962896
monocytes, macrophages and immature DCs contain preformed intracellular CD83, and its rapid surface expression upon activation is post-translationally regulated in a process involving glycosylationPMID:15320871
combined treatment of phosphatidic acid and tumor necrosis factor-alpha induce expression of CD83 in KG1 cells.PMID:15454113
analysis of monomeric and dimeric isoforms of CD83PMID:15721284
Putative soluble forms of CD83 proteins are characterized by a partial deletion of the extracellular and transmembrane domains; the smallest CD83 splice product shows a strong inhibitory effect on T cell proliferation in mixed leukocyte reactions.PMID:15905506
Results suggest the importance of tumor-infiltrating CD83(+) dendritic cells as a useful prognostic factor for patients with gallbladder carcinoma.PMID:16012714
The mature dentritic cells express CD83 and high CD40/80/86, whereas the immature cells express CD1a and low CD40/80/86PMID:17197902
HSV-1 induces CD83 degradation in mature dendritic cells with immediate-early kinetics via the cellular proteasomePMID:17428858
The abundance of CD83+ plasmacytoid dendritic cells (DCs) in perivascular areas and the overexpression of CCL19 and CCL21 in perivascular cellular foci suggest plasmacytoid DCs are central to the muscle inflammation in juvenile dermatomyositis.PMID:17469160
CD83 antigen was identified as a useful tumor marker for the diagnosis of pediatric large cell lymphoma.PMID:17535098
mRNA can be measured by real-time polymerase chain reaction to determine removal of dendritic cells in whole bloodPMID:17561858
membrane expression of the dendritic cell maturation marker CD83 on tumor cells from lung cancer patientsPMID:17628801
CD83 gene polymorphisms increase susceptibility to human invasive cervical cancerPMID:18056445
In rheumatoid arthritis patients, the number of CD304(+) plasmacytoid DCs (pDCs) exceeded that of CD1c(+) myeloid DCs (mDCs), with the majority of infiltrating DCs being CD83(-) or DC-LAMP(-).PMID:18292234
Data suggest that in systemic lupus erythematosus, the increased number of plasmacytoid dendritic cells (DCs) supports a pathogenic role for these cells, and decreased myeloid DC and CD83 expression may explain susceptibility to infections.PMID:18625638
GM-CSF can both synergize with TNFalpha in the case of expression of IL1-RA and antagonize in the case of CD83.PMID:18755511
The CK2 alpha' phosphorylates APRIL and therefore is responsible for the regulation of the nucleocytoplasmic translocation of CD83 mRNA.PMID:19130553
sCD83 release may play a regulatory role in CLL progression.PMID:19195701
Overexpression of CD83 in transgenic mice suppresses the humoral response to both T cell-independent and T-cell dependent model antigens in a dose-dependent manner.PMID:19234177
Show
More
Hide
All
Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.