MGEFNEKKTTCGTVCLKYLLFTYNCCFWLAGLAVMAVGIWTLALKSDYISLLASGTYLAT AYILVVAGTVVMVTGVLGCCATFKERRNLLRLYFILLLIIFLLEIIAGILAYAYYQQLNT ELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVV PDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLRVIGAVGIGIACVQVFGMIF TCCLYRSLKLEHY
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Essential for the proper assembly of the glomerular and tubular basement membranes in kidney.; (Microbial infection) Plays a role in human papillomavirus 16/HPV-16 endocytosis upon binding to cell surface receptor.
Gene References into Functions
Results provide evidence that bi-allelic loss-of-function mutations in CD151 underlie an autosomal recessive mechano-bullous disease with systemic features suggesting that CD151 as the 20th causative, EB-associated gene.PMID:29138120
The expression levels of RNASEH2A, CDK1, and CD151 and their combination could predict the survival of renal cell carcinoma patients.PMID:29843367
We conclude that LAMC1 mRNA acts as a trans regulator to stimulate CD151 expression by competing for miR-124 binding in hepatocellular carcinoma cells.PMID:28524360
CD151 overexpression was associated with poor survival in human solid tumors. CD151 could be a valuable prognosis biomarker or a potential therapeutic target of solid tumors.PMID:27888619
Levels of CD151 Gene Expression are Independently Associated with Survival in Chemoradiotherapy-Naive PatientsPMID:27577713
CD151 induces osteosarcoma metastasis likely by regulating cell function through adhesion signalingPMID:27556355
These results elucidated that PIK3C2A mRNA acts as a miR-124 decoy to regulate CD151 and to affect hepatocellular carcinoma malignant phenotypes.PMID:27270320
the tetraspanin CD151 contributes to survival of a subset of high-grade serous ovarian cancer cell lines.PMID:28273451
CD151 in humans thus marks and enables hyperproliferative T cells.PMID:28954890
Here, we demonstrate for the first time that the tetraspanin CD151 supports lymphocyte adhesion to liver endothelium. We show that CD151 is upregulated in chronic liver disease and hepatocellular carcinoma (HCC) and is regulated on endothelium by tissue remodeling and procarcinogenic factors.PMID:28473332
Our data uncover a previously unknown mechanism for modulating human airway smooth muscle contraction, implicating CD151 as a determinant of airway hyper-responsiveness in vivo, likely through regulation of G protein-coupled receptor-induced calcium mobilization and protein kinase c signalingPMID:27233153
Reciprocal fusion gene involving TSPAN4-CD151 is associated with infratentorial anaplastic ependymoma.PMID:27401149
High CD151 expression is associated with hepatocellular carcinoma.PMID:27599545
Eight and five of the nine samples were negative for cell adhesion molecule 1 and Osterix respectively. The other markers showed no statistical significance(CD151,ALP). osteoblastic differentiation can occur in carcinoma cells and that cell adhesion molecule 1 could be a useful marker for identifying this phenomenon in carcinoma tissues.PMID:28651491
High CD151 expression is associated with Human Cytomegalovirus Infection.PMID:27147745
Knockdown and knockout models revealed that CD151 and Tspan8 act as molecular facilitators in wound healing, angiogenesis and tumor progression. [review]PMID:28408484
CD151 participates in communication between PC3 prostate cancer cells and bone microenvironment and the process can be considered as a significant step of prostate cancer progression and metastasis.PMID:28291843
these findings identify CD151 and its interactions with integrins a3 and a6 as potential therapeutic targets for inhibiting stemness-driving mechanisms and stem cell populations in Glioblastoma.PMID:26992919
CD151 knockdown inhibits the expression of MMP9 through the GSK-3b/bcatenin pathway and also inhibits Osteosarcoma (OS)migration and invasion in vitro and metastasis in vivo in highly metastatic OS.PMID:26707073
the role of the CD151-alpha3beta1 complex in carcinoma progression is context dependent, and may depend on the mode of tumor cell invasion.PMID:26418968
selective interaction with PY12 oligomers is crucial for platelet aggregation and thrombus stabilizationPMID:26245294
In high grade DCIS, when stratified according to the HER2 status, in the HER2-negative subgroup, CD151 assessed in combination with alpha3beta1 was significantly correlated with prognosis.PMID:26464707
Data show that CD151 protein (CD151)-alpha3beta1 integrin complexes cooperated with epidermal growth factor receptor (EGFR) to drive tumor cell motility.PMID:26377974
Tetraspanin CD151 Is a Negative Regulator of FcepsilonRI-Mediated Mast Cell Activation.PMID:26136426
our study demonstrates that CD151-alpha3beta1 integrin complexes regulate ovarian tumor growth by repressing Slug-mediated epithelial to mesenchymal transition and Wnt signalingPMID:25356755
Knockdown CD151 expression by targeted siRNA could inhibit the related downstream intercellular signaling pathways including FAK, PI3KAKT, MEKERK1/2MAPK as well as the expression of MMP9 and VEGF.PMID:25351816
Increased expression of CD151 is associated with gastric cancer.PMID:25119599
might be a potential prognostic indicator for gallbladder carcinomaPMID:24890568
CD151 overexpression is associated with gastric cancer.PMID:24306658
Taken together, it was concluded that CD151 promotes the proliferation and migration of PC3 cells through the formation of CD151-integrin complex and the activation of phosphorylated ERK.PMID:22684562
CD151 expression is associated with lymphatic vessel density in prostate cancer.PMID:24174171
Data indicate that overexpression of CD151 significantly attenuated the tumor suppressive effect of miR-22.PMID:24495805
Review on CD151 in cancer progression and metastasis.PMID:24247563
CD151-AAA mutant was able to promote cell proliferation, while the ability of CD151AAA to promote cell proliferation was decreased compared with the CD151 group.PMID:23007325
High CD151 expression correlated with aggressive behavior in non-small cell lung cancer.High CD151 protein expression was an independent negative prognostic factor for overall survival in lung adenocarcinoma, but not in lung squamous cell carcinomas.PMID:23570797
The expression rate of CD151 seemed to increase gradually according to the depth of invasion and pathologic stage in gastric ademocarcinoma.PMID:24005419
Data indicate that alpha3beta1 and the tetraspanin CD151 directly associate at the front and retracting rear of polarised migrating breast carcinoma cells.PMID:22986527
High CD151 expression is associated with glioma.PMID:22495828
CD151 is positively associated with the invasiveness of HGC, and CD151 or the combination of CD151 and integrin alpha3 is a novel marker for predicting the prognosis of HGC patient.PMID:23533596
Overexpression of CD151 was observed in a significant proportion of glioblastomas. CD151 overexpression was closely associated with MGMT methylation and was a prognostic factor for predicting worse survival.PMID:22926763
High CD151 expression is associated with skin squamous cell carcinoma.PMID:22824799
These data show that complex formation of CD151 with laminin-binding integrins and integration of the complex into tetraspanin-enriched microdomains are critical for human papillomavirus type 16 endocytosis.PMID:23302890
clinical data analyses revealed a strong correlation between CD151 and ErbB2 expression and metastasis-free survival of breast cancer patientsPMID:22952421
CD151 support of alpha6 random defined diffusion is specific and functionally relevant, and probably underlies diverse CD151 functions in skin, kidney and cancer cells.PMID:22328509
CD151 links alpha(3)beta(1)/alpha(6)beta(1) integrins to Ras, Rac1, and Cdc42 by promoting the formation of multimolecular complexes in the membrane, which leads to the up-regulation of adhesion-dependent small GTPase activationPMID:22843693
Secreted CD151 can be a useful genetic marker for the diagnosis of metastatic prostate cancer.PMID:22457534
CD151 overexpression in breast cancer was found to be significantly associated with larger tumour size, higher nodal stage, advanced stage, absence of oestrogen receptor and progesterone receptor and human epidermal growth factor receptor 2 overexpressionPMID:22294188
Data show that CD151 acts as an important player in the progression of HCC in an integrin beta1-dependent manner.PMID:21961047
Show
More
Hide
All
Subcellular Location
Membrane; Multi-pass membrane protein.
Protein Families
Tetraspanin (TM4SF) family
Tissue Specificity
Expressed in a variety of tissues including vascular endothelium and epidermis. Expressed on erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes.