Recombinant Human C3a anaphylatoxin chemotactic receptor (C3AR1)-VLPs

CSB-MF620968HU
Size:
20ug
20ug100ug1mg
US$620
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
VLPs
Target Names
C3AR1
Uniprot NO.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-482aa
Target Protein Sequence
MASFSAETNSTDLLSQPWNEPPVILSMVILSLTFLLGLPGNGLVLWVAGLKMQRTVNTIWFLHLTLADLLCCLSLPFSLAHLALQGQWPYGRFLCKLIPSIIVLNMFASVFLLTAISLDRCLVVFKPIWCQNHRNVGMACSICGCIWVVAFVMCIPVFVYREIFTTDNHNRCGYKFGLSSSLDYPDFYGDPLENRSLENIVQPPGEMNDRLDPSSFQTNDHPWTVPTVFQPQTFQRPSADSLPRGSARLTSQNLYSNVFKPADVVSPKIPSGFPIEDHETSPLDNSDAFLSTHLKLFPSASSNSFYESELPQGFQDYYNLGQFTDDDQVPTPLVAITITRLVVGFLLPSVIMIACYSFIVFRMQRGRFAKSQSKTFRVAVVVVAVFLVCWTPYHIFGVLSLLTDPETPLGKTLMSWDHVCIALASANSCFNPFLYALLGKDFRKKARQSIQGILEAAFSEELTRSTHCPSNNVISERNSTTV
Mol. Weight
55.2 kDa
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • Recombinant Human C3a anaphylatoxin chemotactic receptor (C3AR1)-VLPs

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for the chemotactic and inflammatory peptide anaphylatoxin C3a. This receptor stimulates chemotaxis, granule enzyme release and superoxide anion production.
Gene References into Functions
  1. High C3aR1 expression is associated with acute myeloid leukemia-M2. PMID:25426664
  2. these findings suggest a critical role for C3a through autocrine/paracrine induction of C3aR in the pathogenesis of cigarette smoke-induced sterile inflammation and provide new therapeutic targets for the treatment of emphysema. PMID:25465103
  3. Medulloblastoma cells express C3aR, and siRNA-mediated knockdown of C3aR inhibits proliferation of these cells in vitro. PMID:25603857
  4. Observed a positive correlation between the expression of anaphylatoxin-receptors C3aR and C5aR with platelet activation in patients with coronary artery disease. PMID:25544179
  5. C3aR and CD46 activation via intrinsic generation of their respective ligands is an integral part of human Th1 (but not Th2) immunity. PMID:24321396
  6. functional regulation of C3aR by NHERFs in human mast cells PMID:23284683
  7. significantly decreased expression of C3aR mRNA and protein expression in placentas with preeclampsia compared to controls PMID:22901903
  8. study demonstrates that although C3a causes phosphorylation of its receptor at multiple sites, Ser459, Thr463, Ser465, Thr466 and Ser470 participate in C3aR desensitization PMID:23077507
  9. Complement C3a receptor activation contributes to the pathogenesis of preeclampsia. PMID:22868393
  10. a new level of complexity for C3aR regulation PMID:21799898
  11. shows that both beta-arrestin-1 and beta-arrestin-2 play a novel and shared role in inhibiting G protein-dependent ERK1/2 phosphorylation. These findings reveal a new level of complexity for C3aR regulation by beta-arrestins in human mast cells PMID:21589858
  12. Mutant gonococci lacking the pilin glycan did not bind to the I-domain when it is in a closed, low-affinity conformation and cannot induce an active conformation to complement receptor 3 during pex cell challenge. PMID:21371235
  13. Sulfation of tyrosine 174 in the human C3a receptor is essential for binding of C3a anaphylatoxin. PMID:12871936
  14. determination of whether the levels of complement factors C3a, C4a, and C5a are elevated at the site of inflammation in chronic obstructive pulmonary disease and in asthma PMID:15039137
  15. Complement receptor 3 (CR3) is involved in the binding of Leishmania promastigote surface antigen-2 leucine-rich repeat motifs to macrophages, an interaction which can be blocked by anti-CR3 antibodies. PMID:15067069
  16. C3a receptor is highly expressed in primary renal proximal tubular epithelial cells in studies that define a new pathway by which complement activation may directly modulate the renal response to immunologic injury. PMID:15356170
  17. C3aR is expressed on plasmacytoid dendritic cells. PMID:16778800
  18. endothelial cells and subendothelial smooth muscle cells express both C3aR and C5aR PMID:17234193
  19. C3a receptor may be used as a unique biomarker of diagnosis and disease activity in patients with lupus nephritis. PMID:17472841
  20. In stenotic valves, expression of C3aR mRNA was upregulated PMID:17498719
  21. on the basis of the location of C3aR and C5aR, C5aR may play a role in activation of inflammatory cells, whereas C3aR may mediate mucus secretion and mucosal swelling in allergic nasal mucosa, especially severe persistent allergic nasal mucosa PMID:18538384

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Widely expressed in several differentiated hematopoietic cell lines, in the lung, spleen, ovary, placenta, small intestine, throughout the brain, heart, and endothelial cells. Mostly expressed in lymphoid tissues.
Database Links

HGNC: 1319

UNIGENE: Hs.504656

KEGG: hsa:719

STRING: 9606.ENSP00000302079

OMIM: 605246

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products