MAEHDYHEDYGFSSFNDSSQEEHQDFLQFSKVFLPCMYLVVFVCGLVGNSLVLVISIFYH KLQSLTDVFLVNLPLADLVFVCTLPFWAYAGIHEWVFGQVMCKSLLGIYTINFYTSMLIL TCITVDRFIVVVKATKAYNQQAKRMTWGKVTSLLIWVISLLVSLPQIIYGNVFNLDKLIC GYHDEAISTVVLATQMTLGFFLPLLTMIVCYSVIIKTLLHAGGFQKHRSLKIIFLVMAVF LLTQMPFNLMKFIRSTHWEYYAMTSFHYTIMVTEAIAYLRACLNPVLYAFVSLKFRKNFW KLVKDIGCLPYLGVSHQWKSSEDNSKTFSASHNVEATSMFQL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for the C-X-C chemokine CXCL16. Used as a coreceptor by SIVs and by strains of HIV-2 and m-tropic HIV-1.
Gene References into Functions
demonstrate that macrophages can promote the migration and invasion of ovarian carcinoma cells by affecting the CXCL16/CXCR6 pathwayPMID:30049511
Identified a population of gut-derived TREG cells producing CCR6 and CXCR6 which are significantly reduced in inflammatory bowel disease.PMID:29981781
The expression of CXCR6 in tumor tissue may serve as a potential prognostic biomarker to refine clinical prognosis prediction combined with traditional clinical and pathological analysis for patients with clear cell renal cell carcinoma (ccRCC) after surgery.PMID:28918166
Data showed that reverse signaling via CXCL16 promotes migration in CXCL16-expressing melanoma and glioblastoma cells, but does not affect proliferation or protection from chemically-induced apoptosis.PMID:28698473
Our results demonstrated that CXCR6 is an independent prognostic factor for poor survival in gastric cancer patients, and may promote gastric cancer metastasis through epithelial-mesenchymal transition.PMID:28440473
In this study, we undertook a comprehensive comparison of CXCR6 gene variation in two South African populations (black and Caucasian) and investigated the possible association between two CXCR6 SNPs and different phenotypes of HIV-1 control in HIV-1-infected black South African individuals.PMID:28428094
Our study demonstrated that CXCL16-CXCR6 mediates CD8(+) T-cell skin trafficking under oxidative stress in patients with vitiligo.PMID:27826097
the DRF motif of CXCR6 may display a receptor adaptation allowing adhesion and cell retention by transmembrane CXCL16 but reducing the chemotactic response to soluble CXCL16.PMID:28267793
this study shows that CXCR6 mRNA levels in osteosarcoma tissues are higher than those in normal bone tissuesPMID:27823764
CXCR6 rs2234358 was associated with HCV spontaneous clearance and response to IFN-alpha/RBV therapy in Chinese Han population.PMID:28456591
The expression level of CXCR6 was increased in gastric cancer.PMID:25921630
The expression of CXCL16 and and its receptor, CXCR6, their immunolocalization in disc tissue and their presence following exposure of cultured human annulus fibrosus cells to proinflammatory cytokines are reported.PMID:27869573
Inflammation contributed to foam cell formation in the radial arteries of ESRD patients via activation of the CXCL16/CXCR6 pathway, which may be regulated by P2X7R.PMID:27877078
High CXCR6 expression is associated with prostate cancer.PMID:26799186
MiR-361-5p was down-regulated in Hepatocellular Carcinoma tissues in comparison to adjacent normal tissues, due to hypermethylation at its promoter region. Overexpression of miR-361-5p suppressed proliferation and invasion of HCC cells. Chemokine (C-X-C Motif) receptor 6 (CXCR6) was identified as a target of miR-361-5p.PMID:26872014
Wnt5a-Ror2 signaling enhances expression and secretion of CXCL16 in mesenchymal stem cells thereby activating CXCR6 expressed on tumor cells to promote proliferation.PMID:26708384
high protein expression of CXCL16 and high protein co-expression of CXCL16/CXCR6 in prostate cancer were independent predictors for a worse clinical outcomePMID:26272362
Authors present evidence that chemokine receptor CXCR6 and its only natural ligand, CXCL16, are significantly expressed by non-small cell lung cancer (NSCLC) and are involved in the pathobiology of lung cancer.PMID:25888629
we examined the expression of CXCL16 and CXCR6 and their relations to prognosis in 335 unselected patients with NSCLC, and investigated possible relationships with our previously studied immunologic and angiogenic markersPMID:26021984
high expression of CXCR6 is positively associated with distant invasion of human hepatocellular carcinoma (HCC) patients.PMID:25572735
CXCL16/CXCR6 interaction may play an important role in modifying the response of pDCs to environmental danger signalsPMID:24302814
Our results suggest that the CXCL16/CXCR6 axis appears to be important in the progression of Ewing sarcoma family tumorPMID:24507753
Data suggest that expression of CXCR6 in T-cells and natural killer cells is up-regulated in subjects with metabolic syndrome and correlates with severity of carotid atherosclerosis (i.e., intima-media thickness and plaque index).PMID:23398954
CXCL16 is highly expressed by glial tumor and stroma cells whereas CXCR6 defines a subset of cells with stem cell character.PMID:23628207
CXCR6 was found to be abundantly expressed in human meningioma samples of different malignant grades.PMID:23229614
the present review proposes and discusses the possibility to modulate tumor self renewal affecting asymmetric/symmetric cell division targeting specific factors such as CXCR6.PMID:22678828
The expressions of CXCL12/CXCR4 and CXCL16/CXCR6 were significantly higher in epithelial ovarian carcinomas than in normal epithelial ovarian tissues or benign epithelial ovarian tumors. Expression of CXCR6 was related to lymph node metastasis.PMID:21527066
CXCL16 and CXCR6 might be involved in the pathophysiology of endometriosis through regulation of the inflammatory response.PMID:21773780
The data supported a role for CCR5, CXCR3, and CXCR6 in the selective recruitment of T cells into renal cell carcinoma tissue and, together with CCR6, in the recruitment of regulatory T cells.PMID:22079021
The results indicated that CXCL16-CXCR6 interactions mediate homing of CD8+ T cells into human skin, and thereby contribute to psoriasis pathogenesis.PMID:22113484
CXCL16 and CXCR6 are elevated in Systemic sclerosis (SSc) serum and on SSc dermal Endothelial cells, respectivelyPMID:21303517
High CXCL16/CXCR6 expression may be related to aggressive cancer behavior, and high CXCL16 expression to bone metastases.PMID:21468586
CXCR6 has a role in aggressive tumor phenotype in melanomaPMID:21203549
The CXCL16 A181V mutation selectively inhibits monocyte adhesion to CXCR6 but is not associated with human coronary heart disease.PMID:21233446
CXCR6 protein was detected in all clinical prostate cancer samples. Both PC3 and LNCap cells expressed CXCR6 mRNA and protein.PMID:20646641
The statistical significance, the replication, and the magnitude of the association demonstrate that CXCR6 is likely involved in the molecular etiology of AIDS and, in particular, in long-term nonprogression.PMID:20704485
data suggest that CXCL16 and CXCR6 may mark cancers arising in an inflammatory milieu and mediate pro-tumorigenic effects of inflammation through effects on cancer cell growth and by inducing the migration and proliferation of tumor-associated leukocytesPMID:19690611
Chemokine receptor expression on MBP-reactive T cells: CXCR6 is a marker of IFNgamma-producing effector cells.PMID:12044980
CCR1, CCR6, and CXCR6 are preferentially expressed by the low cytokine-producing CD8 and CD4(-)CD8(-) subsets of natural killer T-cells.PMID:12070001
There is an association between CXCR6 genotype and progression from Pneumocystis carinii pneumonia to death in African-Americans with AIDS.PMID:12761559
CXCR6 expression is down-regulated, independent of CCR5 or CD69 expression and of cytokine induction, by T cell activation signals that involve predominantly the Ca(2+)-dependent calcineurin pathway.PMID:12914753
The chemokine domain of SR-PSOX/CXCL16 mediated the adhesion of CXCR6-expressing cells, which was not impaired by treatment with pertussis toxin, and was up-regulated by treatment of SR-PSOX/CXCL16-expressing cells with a metalloprotease inhibitor.PMID:14634054
HIV-2 isolates from aviremic and viremic individuals commonly use as coreceptors CCR5, GPR15, and CXCR6PMID:15650194
Immunohistochemistry revealed CXCR6 protein predominantly localised in normal colorectal epithelial cells and some scattered stromal cells. No or weak expression was found in cancerous tissue.PMID:15736401
chemokine receptor CXCR6 was overexpressed in Th1 and Tc1 T lymphocytes compared with peripheral blood lymphocytes in Graves diseasePMID:15817921
CXCR6 was expressed more frequently on synovial T cells than in peripheral bloodPMID:16200580
LPS upregulates CXCR6 mRNA, protein, & surface expression in human aortic smooth muscle cells. Inhibition of TLR4 blocked LPS-mediated CXCR6 expression. LPS stimulated both AP-1 (c-Fos, c-Jun) and NF-kappaB (p50 and p65) activation.PMID:16870145
T cells expressing CCR6, CXCR3, and CXCR6 act coordinately with respective ligands and Th1 inflammatory cytokines in the alveolitic/granuloma phases of the disease.PMID:17615381
Data show that CC chemokine receptor 5 and CXC chemokine receptor 6 expression by lung CD8+ cells correlates with chronic obstructive pulmonary disease severity.PMID:17640964
HIV-1 infected patients with initial viral load suppression due to HAART showed a faster virologic failure in the presence of the CXCR6-3K allelePMID:17725420
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in lymphoid tissues and activated T cells.