Abbreviation
Recombinant Human CCR5 protein-VLPs (Active)
Purity
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 μg/mL can bind Anti-CCR5 recombinant antibody (CSB-RA004844MA1HU). The EC50 is 1.099-1.287 ng/mL.The VLPs (CSB-MP3838) is negative control.
Alternative Names
C-C CKR-5; CC-CKR-5; CCR-5; CCR5; CHEMR13; HIV-1 fusion coreceptor; CD antigen CD195
Species
Homo sapiens (Human)
Expression Region
1-352aa
Target Protein Sequence
MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
CSB-MP004844HU is detected by Mouse anti-6*His monoclonal antibody.(This tag can be tested only under denaturing conditions.)
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CCR5 at 10 μg/ml can bind Anti-CCR5 recombinant antibody (CSB-RA004844MA1HU). The EC50 is 1.099-1.287 ng/mL.The VLPs (CSB-MP3838) is negative control.
-
The purity of VLPs was greater than 95% as determined by SEC-HPLC
Description
CCR5 serves as a critical coreceptor for HIV-1 entry and plays central roles in immune cell trafficking, making it a high-priority target for antiviral and cancer immunotherapy research. This full-length receptor (aa 1–352) is presented in virus-like particles produced in mammalian cells, a format that preserves native membrane topology and conformational epitopes essential for accurate antibody screening and ligand-binding studies. Functional ELISA validation demonstrates specific antibody binding with an EC50 of 1.099–1.287 ng/mL, confirming that the extracellular domains retain their native structure and supports use in therapeutic antibody epitope mapping, competitive inhibition assays, and blocking antibody screening campaigns. With endotoxin levels below 1.0 EU/μg, the preparation meets the quality thresholds commonly required for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and small-molecule inhibitor screening in drug discovery workflows targeting CCR5-mediated pathways.