MTTSLDTVETFGTTSYYDDVGLLCEKADTRALMAQFVPPLYSLVFTVGLLGNVVVVMILI KYRRLRIMTNIYLLNLAISDLLFLVTLPFWIHYVRGHNWVFGHGMCKLLSGFYHTGLYSE IFFIILLTIDRYLAIVHAVFALRARTVTFGVITSIVTWGLAVLAALPEFIFYETEELFEE TLCSALYPEDTVYSWRHFHTLRMTIFCLVLPLLVMAICYTGIIKTLLRCPSKKKYKAIRL IFVIMAVFFIFWTPYNVAILLSSYQSILFGNDCERSKHLDLVMLVTEVIAYSHCCMNPVI YAFVGERFRKYLRHFFHRHLLMHLGRYIPFLPSEKLERTSSVSPSTAEPELSIVF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for C-C type chemokine. Binds and responds to a variety of chemokines, including CCL11, CCL26, CCL7, CCL13, RANTES(CCL5) and CCL15. Subsequently transduces a signal by increasing the intracellular calcium ions level. In addition acts as a possible functional receptor for NARS1.; (Microbial infection) Alternative coreceptor with CD4 for HIV-1 infection.
Gene References into Functions
MACs from Familial hypercholesterolemia (FH)-MACs have an inflammatory phenotype that is characterized by the up-regulation of CCR3, CCR4, and CXCR1 under the control of miR-505-3p. These results suggest a chronic inflammatory condition in FH innate immunity cells that is not reverted by standard lipid-lowering treatmentPMID:29457550
CCR3 exists as a mixture of monomers and dimers under nearly physiological conditions. The monomeric CCR3 receptor is the minimal functional unit in cellular signal transduction. Agonists increase dimers and oligomers at high concentrations. Antagonists do not affect oligomeric status. Monomeric CCR3 exhibits a stronger chemotactic response in the migration assay of stably transfected CCR3 cells.PMID:28994588
Study shows that CCR3, receptor of CCL28, was highly expressed in vascular endothelial cells in lung adenocarcinoma and is targeted by CCL28 to regulate angiogenesis.PMID:27250766
Findings suggest that CCL11-CCR3 binding is involved in the progression of GBM.PMID:27119233
Data show that high mRNA expression of CCR3 was related with improved relapse-free survival in luminal-A/B.PMID:27086913
the expression of CCR3 on dispersed synovial tissue and peripheral blood cells in rheumatoid arthritis, was investigated.PMID:27495116
Chemokine receptors CCR3 and CCR4, and the mucosa specific chemokine CCL28 have predominant roles in oral wound healing by increasing human gingiva fibroblast proliferation, migration, and the secretion of IL-6 and HGF and reducing the secretion of TIMP-1.PMID:28387445
simvastatin was demonstrated to inhibit IL-5-induced CCR3 expression and chemotaxis of eosinophils mediated via the mevalonate pathway.PMID:27275740
Data indicate that approximately 4.5% dispersed osteoarthritis (OA) synovial tissue cells are CC chemokine receptor CCR 3 (CCR3)+ cells.PMID:26409848
This meta-analysis provides robust estimates that interleukin 18 receptor accessory protein rs917997 and chemokine (C-C motif) receptor 3 rs6441961 are potential risk factors for celiac disease in European populations.PMID:26289103
Periprostatic adipocytes drive prostate cancer progression in obesity via CCL7 secretion which stimulates CCR3 expressing tumor cells.PMID:26756352
Results show the structure of CCL11 bound to the sulfated N-terminal region of its receptor CCR3 and show that intact CCR3 is sulfated and sulfation enhances receptor activity.PMID:25450766
CCL28-CCR3 interactions are involved in the homeostatic trafficking of CD4(+) T cells to the upper airways.PMID:24917456
In vitro chemotaxis assay indicates dominant role of RANTES and IP-10 in the selective recruitment of CXCR3(+)CCR5(+)cells at the tubercular pathologic sites.PMID:23643185
CCR3-driven communication pathways from the epidermis to the dermis may modulate tissue remodeling in atopic skin inflammation.PMID:23702389
CCR3 demonstrates adequate sensitivity (83%) but weak specificity (59%) in its ability to reliably identify histamine-releasing activated basophils.PMID:23955446
Chemokine CCR3 ligands-binding peptides derived from a random phage-epitope library.PMID:23183094
Different GATA factors dictate CCR3 transcription in allergic inflammatory cells in a cell type-specific manner.PMID:23636060
rs3091250 single nucleotide polymorphism for CCR3 was found to be associated with age-related macular degeneration.PMID:23566847
CCR3 is strongly expressed by ASM cells in vitro and in vivo. Protection against cell death by CCR3 activation is dependent on p42/44 MAPK but does not affect caspase 3 mediated apoptosis.PMID:22702503
Methylation of CpG sites at the GATA elements in the regulatory regions fine-tunes CCR3 transcription.PMID:22217447
Cross-talk between CCR3 and VEGF signaling exists and may be important in choroidal neovascularization in human age-related macular degeneration.PMID:21917937
These results suggest that pulmonary epithelial CCR3 be involved in progression of lipopolysaccharide-induced lung inflammation by mediating release of IL-8.PMID:21660963
Data show that expression levels of CCL11 and CCR3 mRNA in the lesional skin of ALCL were significantly higher than those in normal skin.PMID:21406396
Leucocyte of children with infectious mononucleosis expressed higher level of CCR3 and lower level of CCR5.PMID:21280323
GATA-1 controls CCR3 transcription by interacting dynamically with multiple GATA sites in the regulatory region of the CCR3 gene.PMID:21041734
CCR3 expression in T-cells and the colon is increased in ulcerative colitis compared to inflammatory bowel disease and controls.PMID:21077277
CCR3 is differentially expressed on inflammatory cells in rheumatoid arthritis, while eotaxin-2, a potent CCR3 agonist, is differentially expressed in active disease.PMID:20659406
CCR3 genetic polymorphisms may contribute to the development of the aspirin exacerbated respiratory disease phenotype and may be used as a genetic marker for differentiating between the two major aspirin hypersensitivity phenotypes.PMID:20022477
interaction of eotaxins and CCR3 regulates the Th2-dominant tumor environment, which is closely related to the development of cutaneous T-cell lymphomaPMID:20505746
The T17C chemokine receptor 3 polymorphism appears to be associated with asthma BHR and disease severity but not with atopy.PMID:20726325
The present data are of interest with regard to the potential use of AZD3778 in allergic rhinitis and to the relative importance of eosinophil actions to the symptomatology of allergic rhinitis.PMID:20144207
data support the role of DCs in differential regulation of CCR3 and CCR4 on CD4+ T cells from HDM-sensitive and non-atopic asthmatics after Der p 1 exposure.PMID:20364559
Data show that both plasma eotaxin level and expression of CCR3 on CD4+ T cells were higher in allergic patients than controls in different types of allergy.PMID:20306659
Alanine scanning mutagenesis of CCR3 reveals that the three intracellular loops are essential for functional receptor expression.PMID:11920572
bronchial expression up-regulated in exacerbations of chronic bronchitisPMID:11991282
demonstrated that CCR3 is absent from the testesPMID:11994538
downstream promoter element dependent, general transcription control mechanism is conserved between Drosophila and human genesPMID:12079287
CCR3 is expressed by dendritic cells (DCs) differentiated from blood monocytes, DCs that emigrate from skin (epidermal and dermal DCs), and DCs derived from CD34+ hemopoietic precursors in bone marrow, umbilical cord blood, and leukapheresis collection.PMID:12218106
results suggest that expression of chemokine receptor 3(CCR3) and its ligand eotaxin/CCL11 plays a role in the recruitment and retention of CD30(+) malignant T cells to the skinPMID:12393570
This protein mobilizes to the surface of human mast cells and potentiates immunoglobulin E-dependent generation of interleukin 13.PMID:12654630
Eosinophil CCR3 expression between atopic individuals does not correlate with atopy or serum IgE levels, nor is the status of macrophage-inflammatory protein-1alpha-highly responsive donors associated with increased chemattractant receptor expression.PMID:12794150
eosinophil responses mediated by chemokines acting at CCR3 may be regulated by two distinct mechanisms: the antagonistic effects of CXCR3 ligands and the sequestration of CCL11 by CXCR3-expressing cellsPMID:12884299
Ligation of CCR3 by eotaxin/chemokine ligand (CCL) 11 induces apoptosis in IL-2- and IL-4-stimulated primary CD19+ B cell cultures (approximately 40% apoptotic cells) as well as B cell lines, but has no effect on chemotaxis or cell adhesion.PMID:12902471
Single nucleotide polymorphism is not associated with atopic dermatitis in Japanese.PMID:14581140
the two N-terminal motifs of eotaxin must cooperate with other regions to successfully bind and activate CCR3PMID:14733956
examination of the role of epidermal growth factor receptor in CCR3 signalingPMID:15219825
multiple residues on multiple extracellular domains of hCCR3 are important for coreceptor activity for HIV-1.PMID:15476879
the restoration of CRTH2(chemoattractant receptor-homologous molecule expressed on Th2 cells)/CCR3 expression may be an indicator for optimal recovery after septic shockPMID:15507393
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
In eosinophils as well as trace amounts in neutrophils and monocytes.