MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is a receptor for bradykinin. Could be a factor in chronic pain and inflammation.
Gene References into Functions
The findings revealed that serum B1R levels may provide prognostic information and currently act as potential indicators for progression in atherosclerosis.PMID:28990089
Data show that mRNA and protein of bradykinin type 2 receptors, but not bradykinin type 1 receptors, were abundant in cultured c-Kit+ progenitor cells.PMID:28099911
promotes adhesion of neutrophils to endothelial cellsPMID:24728914
kB1R heterodimerizes with kB2Rs in co-transfected HEK293 cells and natively expressing endothelial cells, resulting in significant internalization and desensitization of the kB1R response in cells pre-treated with kB2R agonist.PMID:25289859
BKR1 and BKR2 gene expression on peripheral monocytes is upregulated in essential hypertensionPMID:24401952
B1 receptor-mediated vasodilatation in myometrial vessels absent in pre-eclampsiaPMID:24304135
B1R agonist acts as a functional stimulus for the secretion of KLK1 and KLK6, an event relevant for kinin production and cell invasion, respectivelyPMID:25503118
Bradykinin B1 receptor signaling depends on receptor endocytosis.PMID:23934212
APJ and B1R can form heterodimers in transfected HEK293 cells and activations of APJ and B1R could up-regulate eNOS phosphorylationPMID:24686079
investigated if expression of B1 and B2 kinin receptors can be affected by IL-4 and IL-13; data show, for the first time, that IL-4 and IL-13 decrease kinin receptors in a STAT6-dependent mechanismPMID:23351078
A novel B1R splice variant and promoter regulatory elements determine tissue-specific B1R expression.PMID:24475248
the relevance of kinin B1 and B2 receptors in bladder cancer, was investigated.PMID:23224295
CPM binding to extracellular loop 2 of the B1R results in positive allosteric modulation of B1R signaling, and disruption of this interaction could provide a novel therapeutic approach to reduce pathological B1R signaling.PMID:24108126
This review focuses on airway MAPK/NFkappaB-dependent kinin receptor upregulation that links the environmental risk factors to airway hyperreactivity and airway inflammation.PMID:23428345
Kinin B1 receptor homo-oligomerization is required for receptor trafficking to the cell surfacePMID:23201435
Bradykinin B1 receptor is induced in inflammatory diseases and contributes to hyperthermia through a vagal sensory mechanism.PMID:22971439
A peptidase-resistant BR agonist had no significant direct or indirect acute effect (4h) on BR expression.PMID:21986309
The transcriptional activity of the B1 receptor for kinins increased in patients with grade 1 and grade 2 endometrial cancer when compared to the control group, whereas it decreased in patients with grade 3 endometrial cancer.PMID:22706224
bradykinin B1 is inhibited by chromomenonesPMID:22088753
The up-regulation of HER2 and B(1)R in precursor lesions of gallbladder carcinoma suggests cross-talk between these two receptors that may be of importance in the modulation of cell proliferation in gallbladder carcinogenesis.PMID:22468084
Taken together, this study demonstrates that Pseudomonas aeruginosa is capable of up-regulating human B1R expression via the NF-kappaB signaling pathway.PMID:22092568
Comparing phospholipase C beta activity and Ca(2+)-regulated signals, a temperature-dependent increase was only observed for bradykinin B(1) but not for bradykinin(2)receptor activation.PMID:21871009
Remote ischemic preconditioning decreases expression of kinin receptors on circulating human neutrophils.PMID:20189583
CPM and B1Rs on cell membranes form a critical complex that potentiates B1R signaling.PMID:21454694
Data suggest that B1R inhibition can reduce BBB damage and cell invasion during autoimmune CNS disease and may offer a novel anti-inflammatory strategy for the treatment of MS.PMID:21216565
Release of metalloproteases-2 and -9 is blocked after silencing of the kinin B1 receptor with a siRNA.PMID:21147512
Severe inflammation characterizes rapidly progressive glomerulonephritides, and expression of the kinin B1 receptor (B1R) associates with inflammation.PMID:20448019
The up-regulation of B1 receptors may contribute to acute inflammatory pain through TRPV1 activation.PMID:20152050
human chondrosarcoma tissues had significantly higher expression of the B1 and B2 receptors comparing to normal cartilagePMID:19885862
Laminar shear stress is a major determinant of functional B1R expression in endothelium.PMID:19661485
B(1)R-epidermal growth factor receptor crosstalk may be a key interaction that maintains tumor growthPMID:19184415
both B1 receptor and gC1q receptor are involved in the vascular leakage induced by hereditary and acquired angioedema plasma.PMID:19796797
B1 and B2 receptor expression was enhanced in tumor cells and tissue adjacent to gastric cancer compared with gastric ulcers.PMID:11710536
Novel mode of action of angiotensin I converting enzyme inhibitors: direct activation of bradykinin B1 receptorPMID:11880373
Bradykinin B1 receptors are upregulated by inflammatory stimuli in bronchial epithelial cells.PMID:12063092
the C-terminal domain participates intimately in the efficacy of B1R and B2R G(q/11) coupling by contributing both positive and negative regulatory epitopes.PMID:12130679
Allergic rhinitis subjects displayed significantly higher expression of B1 receptor mRNA than did the normal subjects.PMID:12165532
B1R exists in caveolae-related lipid rafts (CLRs) in HEK293 cells apparently by default, as a result of their random distribution in the plasma membrane and not by being targeted to the CLR fraction.PMID:12450400
B1 and B2 bradykinin receptors form a complex with enhanced signaling capacityPMID:15033977
Bradykinin B(1) receptor homooligomerization is required for expression of receptors on the cell surface and subsequent constitutive receptor signaling.PMID:15492119
kinin B(1) receptors participate in painful and inflammatory disorders--REVIEWPMID:15520046
slow internalization of B(1)KB(2) was also accompanied by a lack of agonist-induced phosphorylation, that in contrast was observed for B(1)YB(2) and B(1)CB(2), suggesting that putative helix 8 is either directly or indirectly involvedPMID:15634338
the two bradykinin receptors may play a role in blood pressure regulationPMID:15643125
The B1 kinin receptor does not have a major vasomotor or fibrinolytic role in patients with heart failurePMID:15681300
Use of the highly sensitive DNase I in vivo footprinting approach to delineate more precisely the functional domains of the BDKRB1 gene promoter in human smooth muscle cells is reported.PMID:15705059
bradykinin receptors in imflammatory bowel disease may reflect intestinal inflammationPMID:15805101
A novel class of 2,3-diaminopyridine bradykinin B1 receptor antagonists is disclosed using structure-activity relationship studies.PMID:15837330
BK-1Rs are induced in the endothelium of intramyocardial coronary vessels in failing human hearts and so may participate in the pathogenesis of heart failure.PMID:15840906
Kinin B1 receptor expression on multiple sclerosis mononuclear cellsPMID:15883268
Increased level of bradykinin receptor B1 in adenoma suggests that kinins may play a role in abnormal cellular transformation.PMID:16644486