Recombinant Human Atypical chemokine receptor 3 (ACKR3)-VLPs

Code: CSB-MP006257HU(A4)
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
Pls inquire
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ACKR3
Uniprot NO.
Research Area
Signal Transduction
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
1-362aa
Target Protein Sequence
MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLFGSIFFLTCMSVDRYLSITYFTNTPSSRKKMVRRVVCILVWLLAFCVSLPDTYYLKTVTSASNNETYCRSFYPEHSIKEWLIGMELVSVVLGFAVPFSIIAVFYFLLARAISASSDQEKHSSRKIIFSYVVVFLVCWLPYHVAVLLDIFSILHYIPFTCRLEHALFTALHVTQCLSLVHCCVNPVLYSFINRNYRYELMKAFIFKYSAKTGLTKLIDASRVSETEYSALEQSTK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
If you have specified tag type, please tell us and we will check if it’s possible to develop.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from PBS, 6% Trehalose, pH 7.4
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Atypical chemokine receptor that controls chemokine levels and localization via high-affinity chemokine binding that is uncoupled from classic ligand-driven signal transduction cascades, resulting instead in chemokine sequestration, degradation, or transcytosis. Also known as interceptor (internalizing receptor) or chemokine-scavenging receptor or chemokine decoy receptor. Acts as a receptor for chemokines CXCL11 and CXCL12/SDF1. Chemokine binding does not activate G-protein-mediated signal transduction but instead induces beta-arrestin recruitment, leading to ligand internalization and activation of MAPK signaling pathway. Required for regulation of CXCR4 protein levels in migrating interneurons, thereby adapting their chemokine responsiveness. In glioma cells, transduces signals via MEK/ERK pathway, mediating resistance to apoptosis. Promotes cell growth and survival. Not involved in cell migration, adhesion or proliferation of normal hematopoietic progenitors but activated by CXCL11 in malignant hemapoietic cells, leading to phosphorylation of ERK1/2 (MAPK3/MAPK1) and enhanced cell adhesion and migration. Plays a regulatory role in CXCR4-mediated activation of cell surface integrins by CXCL12. Required for heart valve development. Acts as coreceptor with CXCR4 for a restricted number of HIV isolates.
Gene References into Functions
  1. this study shows an essential role of CXCR7, together with CXCR4, in the control of normal and malignant hematopoietic cell migration and homing induced by CXCL12. PMID:29433559
  2. Expression of CXCR7 associates with increased survival in CXCR4+ but not in CXCR4- DLBCL patients. CXCR7 overexpression in vitro is able to diminish DLBCL cell survival and increase their sensitivity to antitumor drugs. PMID:29920526
  3. Residues 2-6 of ACKR3 form an antiparallel beta-sheet with the beta1 strand (residues 25-29) of CXCL12. PMID:28098154
  4. These findings suggest that the manipulation of miR-539-5p/CXCR7 levels may have important therapeutic implications in choroidal neovascularization-associated diseases PMID:29146732
  5. CXCR7 is an oncogene in PCa that can promote aggressive progression of PCa through enhancing proliferation and migration of the tumor cells. PMID:30047547
  6. Study shows that overexpression of CXCR7 in different cellular populations of endometriosis microenvironment may play a role in the pathogenesis and represent a novel target for treatment. PMID:29587613
  7. CXCR7 silencing inhibits the migration and invasion of human tumor endothelial cells derived from hepatocellular carcinoma by suppressing STAT3. PMID:29901083
  8. Hetero-oligomerization of a1B/D-adrenergic receptor with the chemokine (C-X-C motif) receptor 4:atypical chemokine receptor 3 heteromeric complex is required for a1B/Dadrenergic receptor function PMID:28862946
  9. This work demonstrates distinct roles for the SDF-1/CXCR4 or CXCR7 network in human induced pluripotent stem cell-derived ventricular cardiomyocyte specification, maturation and function. PMID:28711757
  10. A role for CXCR7 in bladder cancer [review] PMID:29022185
  11. CXCR7-small hairpin RNA inhibits tumour invasion and metastasis. PMID:28429395
  12. Chemokine receptor CXCR7 may involve in the clinical glioblastoma (GBM) progression, and CXCR7 could be a valuable prognostic marker in the treatment of GBM. PMID:28759950
  13. Therefore, CXCR7 may be associated with peritoneal metastasis in gastric cancer. PMID:27941339
  14. CXCL12-CXCR7 axis accelerates migration and invasion of pancreatic cancer cells through mTOR and Rho/ROCK pathways, and predicts poor prognosis of pancreatic cancer PMID:27542220
  15. The CXCR7/CXCL12 axis is involved in lymph node and liver metastasis of gastric cancer. PMID:28533662
  16. Among 479 individuals affected with clear cell renal cell carcinoma, only synonymous variants were found in COPS8 and one of the missense variants in ACKR3:c.892C>T, was observed in 4/479 individuals screened PMID:28063109
  17. Results show that CXCR7 is highly expressed in metastatic lymph node (MNL) of non-small cell lung neoplasm (NSCLC) and is associated with poor prognosis. PMID:29032612
  18. While the potencies of all proteins in ACKR3 Presto-Tango assays were comparable, the efficacy of CXCL12(3-68) to activate ACKR3 was significantly reduced PMID:29125867
  19. CXCR7 mediates CD14(+)CD16(+) monocyte transmigration across the blood brain barrier, and is a potential therapeutic target for neuro AIDS. PMID:28754798
  20. CXCR7 signaling could not be detected using impedance measurements. However, increasing levels of CXCR7 expression significantly reduced the CXCR4-mediated impedance readout, suggesting a regulatory role for CXCR7 on CXCR4-mediated signaling. PMID:28945785
  21. CXCR7 expression in gastric cancer tissues was significantly higher than that in adjacent non-cancer tissues and associated with tumor size, TNM stage and lymph node metastasis. CXCR7 was identified as a novel promoter in gastric cancer initiation and progression. PMID:28281844
  22. the data identified the pivotal role of the receptor CXCR7 in pulmonary inflammation with a predominant effect on the pulmonary epithelium and polymorphonuclear neutrophils PMID:28188248
  23. SDF-1/CXCR7 plays a positive role in the proliferation and invasion of endometrial carcinoma cells. PMID:28239742
  24. our study demonstrates that the upregulation of CXCR7 signaling contributes to increased vasculogenic capacity of EOCs from CAD patients, indicating that CXCR7 signaling may be a novel therapeutic vasculogenic target for CAD. PMID:27612090
  25. CXCR7 expression in the tumor cells and stromal cells from the metastatic foci was significantly more common in the group of male patients treated with cytotoxic drugs according to the FOLFOX6 regimen PMID:28295006
  26. hypoxia and CXCL12-CXCR7 axis appeared to be advantageous microenvironments to CD20(-) CD138(-) cells in lymphoplasmacytic lymphoma PMID:26878134
  27. suppressing CXCR4 is not enough to impede osteosarcoma invasion in bone marrow microenvironment since CXCR7 is activated to sustain invasion. Therefore, inhibiting both CXCR4 and CXCR7 could be a promising strategy in controlling osteosarcoma invasion. PMID:28468584
  28. This short review intends to provide a concise summary of current knowledge with regards to cell-specific functions of CXCL12 and its receptors CXCR4 and CXCR7 with potential implications for the initiation and progression of atherosclerosis. [review] PMID:25586789
  29. CXCR7 overexpression is associated with gastric cancer. PMID:27716367
  30. CXCL12 may be an effective diagnostic marker for papillary thyroid carcinoma, and CXCL12/CXCR4/CXCR7 axis may contribute to thyroid cancer development by regulating cancer cell migration and invasion via AKT and ERK signaling and MMP-2 activation. PMID:27082011
  31. Our study suggested that CXCR7 plays an important proangiogenic role in hepatocellular carcinoma (HCC). via activation of the AKT pathway. So CXCR7 may be a potential target for antiangiogenic therapy in HCC PMID:27572688
  32. CXCR7 is a direct downstream target of miR-100, and overexpression of miR-100 efficiently suppresses CXCR7 expression. PMID:27035873
  33. Overexpression of CXCR7 is associated with breast cancer. PMID:27460092
  34. High CXCR7 expression is associated with endometrial cancer. PMID:26678890
  35. the current study revealed that CXCL12 which combined its receptors CXCR4 and CXCR7 together could promote cell migration and cell invasion of OSCC. PMID:26232325
  36. Increased CXCR7 expression is associated with invasion in nasopharyngeal carcinoma. PMID:26715277
  37. Up-regulation of miR-218 expression in renal cell carcinoma under hypoxia can result in significant and targeted down-regulation of CXCR7 expression. PMID:27133059
  38. CXCR7 affects the growth of PTC cells. PMID:26383519
  39. CXCR7 may play a role in the progression, metastasis and angiogenesis of otorhinolaryngologic tumours. PMID:26996902
  40. CXCR4 was co-expressed with all investigated neural and embryonic stem cell markers in both primary and recurrent tissues, whereas CXCR7 was mostly found on stem cell marker-negative cells, but was co-expressed with KLF-4 on a distinct GBM cell subpopulation PMID:26821357
  41. Expression levels of CXCR4 and CXCR7 in breast cancer tissues were significantly higher than that in adjacent normal tissues and patients with high CXCR4 and CXCR7 expression had a shorter survival time compared with those with low expression. PMID:26722521
  42. Data shows the relative expression of CXCR4 and CXCR7 in platelets, their dynamic trafficking, how they differentially mediate the functional and survival response to some chemokines, and their prognostic value in coronary artery disease. [review] PMID:26551719
  43. CXCR7 expression in colorectal carcinoma was correlated with tumor development and poor prognosis of patients. PMID:26722500
  44. TGFbeta1-CXCR7 axis may be a prognostic marker and may provide novel targets for combinational therapies to be used in the treatment of advanced lung cancer in the future PMID:26212008
  45. Evidences suggest an indispensable role of GLI1 in the migration and metastasis of breast cancer cells through CXCL12/CXCR4 signaling enhancement. PMID:26413813
  46. Developmental expression patterns of chemokines CXCL11, CXCL12 and their receptor CXCR7 in testes PMID:25810367
  47. STAT3 signaling downstream of CXCR7 is involved in miR-101 regulation of breast cancer cell behaviors. PMID:26360780
  48. CXCR7 is expressed on NogoA- and Nkx2.2-positive oligodendroglial cells in human multiple sclerosis brains. PMID:26741980
  49. This study found that elevated mRNA levels for CXCR7 (+29%; p<.0001) and CXCR4 (+14%, p=.052) in schizophrenia subjects. PMID:25464914
  50. the roles of CXCR4, CXCR7, and CXCL12 are associated with trophoblastic cells apoptosis and may be linked to the occurrence and development of severe preeclampsia PMID:26721717

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cytoplasm, perinuclear region. Early endosome. Recycling endosome. Note=Predominantly localizes to endocytic vesicles, and upon stimulation by the ligand is internalized via clathrin-coated pits in a beta-arrestin-dependent manner. Once internalized, the ligand dissociates from the receptor, and is targeted to degradation while the receptor is recycled back to the cell membrane.
Protein Families
G-protein coupled receptor 1 family, Atypical chemokine receptor subfamily
Tissue Specificity
Expressed in monocytes, basophils, B-cells, umbilical vein endothelial cells (HUVEC) and B-lymphoblastoid cells. Lower expression detected in CD4+ T-lymphocytes and natural killer cells. In the brain, detected in endothelial cells and capillaries, and in
Database Links

HGNC: 23692

UNIGENE: Hs.471751

KEGG: hsa:57007

STRING: 9606.ENSP00000272928

OMIM: 610376

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products