Recombinant Human Aquaporin-9 (AQP9)

Code: CSB-CF001973HU
Size:
20μg
20μg100μg
US$5643
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
AQP9
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-295
Target Protein Sequence
MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Forms a water channel with a broad specificity. Also permeable glycerol and urea. Mediates passage of a wide variety of small, non-charged solutes including carbamides, polyols, purines, and pyrimidines.
Gene References into Functions
  1. downregulation of AQP9 in cultured chondrocytes decreased the catabolic gene expression in response to IL1beta stimulation through nuclear factorkappaB signaling. PMID:29901079
  2. AQP9 together with CLDN2 may have a role regulating tissue-specific physiological properties in tight junctions in UC. An additional functional role for AQP9 in the synthesis and/or the function of mucus can be implied. PMID:29040430
  3. Data suggest that expression of aquaporin-9 in term placenta is up-regulated by leptin. These studies used placental explants following term birth via cesarean section. PMID:28942694
  4. These findings showed that eclamptic seizures induced cell death and that upregulation of AQP4 and AQP9 may play an important role in this pathophysiological process. PMID:29351212
  5. AQP9 transports two clinically important for anticancer therapy compounds, monomethyselenic acid and selenite. PMID:28798983
  6. The identification of AQP9-induced tumor sensitivity to 5-Fluorouracil highlights the role of AQP9 in regulating chemosensitivity in colorectal cancer. PMID:28640255
  7. AQP9 is down-regulated in hepatocellular carcinoma and its over-expression suppresses hepatoma cell invasion through inhibiting epithelial-to-mesenchymal transition. PMID:27216981
  8. pH-dependent substrate permeability, measurements of media alkalization, and proton decoupling that AQP9 acts as a channel for the protonated, neutral monocarboxylic acid species. PMID:28360107
  9. AQP9 is involved in the activation of the ERK pathway in androgen-independent prostate cancer cells. PMID:27187384
  10. trophoblast from gestational diabetes express higher amount of aquaporin 9. PMID:27082037
  11. AQP9 decreases in hepatocellular carcinoma. Dibutrylyl cAMP increases AQP9 levels, suppressing tumor growth. PMID:27022216
  12. Our findings implicate the involvement of AQP9 in H2O2 transport in human and mice cells. PMID:26837049
  13. we suggest that AQP9 is involved in viral tropism and pathogenesis of Herpes simplex encephalitis PMID:25604497
  14. AQP9 downregulation together with the subsequent reduction in hepatic glycerol permeability in insulin-resistant states emerges as a compensatory mechanism whereby the liver counteracts further triacylglycerol accumulation PMID:24418844
  15. AQP9 expressing glioma cells were negative for the brain tumor stem cell marker CD15. PMID:24086629
  16. Placental expression of the arsenic transporter AQP9 was positively associated with maternal urinary arsenic levels during pregnancy. AQP9 expression related to phospholipase ENPP2 expression which was positively associated with infant birth weight. PMID:23866971
  17. Reduced expression of AQP9 in human fallopian tube may contribute to aspects of pathophysiology of tubal ectopic pregnancy. PMID:23238960
  18. AQP9, rather than other biomarkers such as cell surface markers and chromosomal alterations, correlate closely with the sensitivity to arsenic trioxide in acute promyelocytic leukemia cell lines. PMID:23563754
  19. The identification of novel, high affinity AQP9 inhibitors in an intracellular binding site. PMID:23448163
  20. The interplay of water fluxes through AQP9 and actin dynamics regulate the cellular protrusive and motile activity of cells. PMID:23573219
  21. AQP9 expression is lower in patients with stage III colorectal cancer who do not respond to adjuvant chemotherapy PMID:23612070
  22. There is a coordinated regulation of adipose AQP7 and hepatic AQP9 gene expression that is distorted in metabolic syndrome X. (Review) PMID:22425521
  23. Multi-tissue gene expression studies reveal SERPINA1 and AQP9 variants as genes for atherosclerosis. PMID:22916037
  24. Using transcriptional signatures of blood samples,identified S100A11 as a potential diagnostic marker of infective endocarditis, and AQP9 as a potential prognostic factor. PMID:22319637
  25. Aquaporin 9 is linked to the tumorigenesis of glioblastoma. PMID:22262958
  26. The expression levels of aquaporin 9 were approximately 2 times higher in the chorion cells than those in the amnion cells following arsenite administration. PMID:21945491
  27. AQP9 plays an active role in neutrophil volume regulation and migration PMID:21873454
  28. Elevated serum levels of human chorionic gonadotrophin may be involved in increased aquaporin-9 protein expression in preeclamptic placenta explants via adenosine 3',5'-cyclic phosphate pathways. PMID:20220109
  29. Genetic variation in the AQP9 gene is associated with femoral neck BMD in postmenopausal women, and may represent one of the susceptibility genes for phenotypes related to bone mass PMID:20960106
  30. insulin treatment inhibited the expression of AQP9 in normal liver cells PMID:20587318
  31. Hyperandrogenism in follicular fluid of women with polycystic ovary syndrome inhibited AQP-9 in granulosa cells through the PI3K pathway. PMID:20378617
  32. The examination was performed whether aquaporin (AQP) 9 is expressed in normal skeletal muscle at mRNA and protein levels. PMID:19629726
  33. The results suggest that in addition to the initial uptake of trivalent inorganic As(III) inside cells, AQP9 plays a dual role in the detoxification of arsenic metabolites by facilitating efflux from cells. PMID:19802720
  34. AQP9 expression in fetal membranes was significantly higher in spontaneous term labor when compared with term-not in labor membranes. PMID:19916714
  35. AQP9 can modulate drug sensitivity in cancer. PMID:15336539
  36. The APQ9 mRNA expression in fetal membranes suggest that APQ9 may be an important water channel in intramembranous amniotic fluid water regulation. PMID:15592307
  37. results provide new evidences that suggest the involvement of AQP9 and UT-A in the urea excretion mechanism across human term placenta from mother to fetus in physiological conditions PMID:16480766
  38. We propose that increased water influx through AQP9 is critically involved in the formation of membrane protrusions, and that AQP9-induced actin polymerization is augmented by activation of Cdc42 and PKC(zeta). PMID:17346701
  39. The expression of AQP9 in glioblastoma was studied. PMID:17525633
  40. decreased hepatic AQP9 expression observed in obese T2DM subjects suggests a potential role in glycerol release from adipose tissue PMID:18401671
  41. Results indicate that aquaporin-9 may play an important role in the malignant progression of brain astrocytic tumours. PMID:18652774
  42. hAQP9 functions as a facilitative carrier for glycerol. PMID:18762715
  43. The present study strongly suggests that membrane transporters responsible for arsenic uptake, such as AQP9, may play a critical role in development of arsenic resistance in human lung cancer cells. PMID:19100828
  44. CFTR expression decreases in preeclampsia and may thus be implicated in the regulation of AQP9 activity PMID:19481256
  45. we found a greater expression found in visceral fat, and between subcutaneous adipose aquaporin 7 and hepatic AQP9 gene expression within the context of human morbid obesity PMID:19615702

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.
Database Links

HGNC: 643

UNIGENE: Hs.104624

KEGG: hsa:366

STRING: 9606.ENSP00000219919

OMIM: 602914

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products