MQPEGAEKGKSFKQRLVLKSSLAKETLSEFLGTFILIVLGCGCVAQAILSRGRFGGVITINVGFSMAVAMAIYVAGGVSGGHINPAVSLAMCLFGRMKWFKLPFYVGAQFLGAFVGAATVFGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLANAFADQVVATMILLIIVFAIFDSRNLGAPRGLEPIAIGLLIIVIASSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFRAGNNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Forms a water channel with a broad specificity. Also permeable glycerol and urea. Mediates passage of a wide variety of small, non-charged solutes including carbamides, polyols, purines, and pyrimidines.
Gene References into Functions
downregulation of AQP9 in cultured chondrocytes decreased the catabolic gene expression in response to IL1beta stimulation through nuclear factorkappaB signaling.PMID:29901079
AQP9 together with CLDN2 may have a role regulating tissue-specific physiological properties in tight junctions in UC. An additional functional role for AQP9 in the synthesis and/or the function of mucus can be implied.PMID:29040430
Data suggest that expression of aquaporin-9 in term placenta is up-regulated by leptin. These studies used placental explants following term birth via cesarean section.PMID:28942694
These findings showed that eclamptic seizures induced cell death and that upregulation of AQP4 and AQP9 may play an important role in this pathophysiological process.PMID:29351212
AQP9 transports two clinically important for anticancer therapy compounds, monomethyselenic acid and selenite.PMID:28798983
The identification of AQP9-induced tumor sensitivity to 5-Fluorouracil highlights the role of AQP9 in regulating chemosensitivity in colorectal cancer.PMID:28640255
AQP9 is down-regulated in hepatocellular carcinoma and its over-expression suppresses hepatoma cell invasion through inhibiting epithelial-to-mesenchymal transition.PMID:27216981
pH-dependent substrate permeability, measurements of media alkalization, and proton decoupling that AQP9 acts as a channel for the protonated, neutral monocarboxylic acid species.PMID:28360107
AQP9 is involved in the activation of the ERK pathway in androgen-independent prostate cancer cells.PMID:27187384
trophoblast from gestational diabetes express higher amount of aquaporin 9.PMID:27082037
Our findings implicate the involvement of AQP9 in H2O2 transport in human and mice cells.PMID:26837049
we suggest that AQP9 is involved in viral tropism and pathogenesis of Herpes simplex encephalitisPMID:25604497
AQP9 downregulation together with the subsequent reduction in hepatic glycerol permeability in insulin-resistant states emerges as a compensatory mechanism whereby the liver counteracts further triacylglycerol accumulationPMID:24418844
AQP9 expressing glioma cells were negative for the brain tumor stem cell marker CD15.PMID:24086629
Placental expression of the arsenic transporter AQP9 was positively associated with maternal urinary arsenic levels during pregnancy. AQP9 expression related to phospholipase ENPP2 expression which was positively associated with infant birth weight.PMID:23866971
Reduced expression of AQP9 in human fallopian tube may contribute to aspects of pathophysiology of tubal ectopic pregnancy.PMID:23238960
AQP9, rather than other biomarkers such as cell surface markers and chromosomal alterations, correlate closely with the sensitivity to arsenic trioxide in acute promyelocytic leukemia cell lines.PMID:23563754
The identification of novel, high affinity AQP9 inhibitors in an intracellular binding site.PMID:23448163
The interplay of water fluxes through AQP9 and actin dynamics regulate the cellular protrusive and motile activity of cells.PMID:23573219
AQP9 expression is lower in patients with stage III colorectal cancer who do not respond to adjuvant chemotherapyPMID:23612070
There is a coordinated regulation of adipose AQP7 and hepatic AQP9 gene expression that is distorted in metabolic syndrome X. (Review)PMID:22425521
Multi-tissue gene expression studies reveal SERPINA1 and AQP9 variants as genes for atherosclerosis.PMID:22916037
Using transcriptional signatures of blood samples,identified S100A11 as a potential diagnostic marker of infective endocarditis, and AQP9 as a potential prognostic factor.PMID:22319637
Aquaporin 9 is linked to the tumorigenesis of glioblastoma.PMID:22262958
The expression levels of aquaporin 9 were approximately 2 times higher in the chorion cells than those in the amnion cells following arsenite administration.PMID:21945491
AQP9 plays an active role in neutrophil volume regulation and migrationPMID:21873454
Elevated serum levels of human chorionic gonadotrophin may be involved in increased aquaporin-9 protein expression in preeclamptic placenta explants via adenosine 3',5'-cyclic phosphate pathways.PMID:20220109
Genetic variation in the AQP9 gene is associated with femoral neck BMD in postmenopausal women, and may represent one of the susceptibility genes for phenotypes related to bone massPMID:20960106
insulin treatment inhibited the expression of AQP9 in normal liver cellsPMID:20587318
Hyperandrogenism in follicular fluid of women with polycystic ovary syndrome inhibited AQP-9 in granulosa cells through the PI3K pathway.PMID:20378617
The examination was performed whether aquaporin (AQP) 9 is expressed in normal skeletal muscle at mRNA and protein levels.PMID:19629726
The results suggest that in addition to the initial uptake of trivalent inorganic As(III) inside cells, AQP9 plays a dual role in the detoxification of arsenic metabolites by facilitating efflux from cells.PMID:19802720
AQP9 expression in fetal membranes was significantly higher in spontaneous term labor when compared with term-not in labor membranes.PMID:19916714
AQP9 can modulate drug sensitivity in cancer.PMID:15336539
The APQ9 mRNA expression in fetal membranes suggest that APQ9 may be an important water channel in intramembranous amniotic fluid water regulation.PMID:15592307
results provide new evidences that suggest the involvement of AQP9 and UT-A in the urea excretion mechanism across human term placenta from mother to fetus in physiological conditionsPMID:16480766
We propose that increased water influx through AQP9 is critically involved in the formation of membrane protrusions, and that AQP9-induced actin polymerization is augmented by activation of Cdc42 and PKC(zeta).PMID:17346701
The expression of AQP9 in glioblastoma was studied.PMID:17525633
decreased hepatic AQP9 expression observed in obese T2DM subjects suggests a potential role in glycerol release from adipose tissuePMID:18401671
Results indicate that aquaporin-9 may play an important role in the malignant progression of brain astrocytic tumours.PMID:18652774
hAQP9 functions as a facilitative carrier for glycerol.PMID:18762715
The present study strongly suggests that membrane transporters responsible for arsenic uptake, such as AQP9, may play a critical role in development of arsenic resistance in human lung cancer cells.PMID:19100828
CFTR expression decreases in preeclampsia and may thus be implicated in the regulation of AQP9 activityPMID:19481256
we found a greater expression found in visceral fat, and between subcutaneous adipose aquaporin 7 and hepatic AQP9 gene expression within the context of human morbid obesityPMID:19615702
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
MIP/aquaporin (TC 1.A.8) family
Tissue Specificity
Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.