EVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWGGSYTSMGLIALAVLACLLFLLIVGFTSRFKRQTSYQGVL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
10xHis-SUMO-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells.
Gene References into Functions
We have studied the relation of CD1d expression in various breast cancer cell lines to their viability and progression. We observed a novel phenomenon that CD1d expression level increases with the progressive stage of the cancer.PMID:28633979
CD1D has a role in disease progression and survival of chronic lymphocytic leukemia and may interact with CD161PMID:27385215
CD1d-expressing cells isolated from peripheral blood of allogeneic hematopoietic stem cell transplantation patients showed the suppressive activity of T cell proliferation and higher expression of MyD88 and IDO compared with CD1d(-) cells.PMID:29108995
These findings suggest that VP22 is required (but not sufficient) for the inhibition of CD1d-mediated antigen presentation in herpes simplex virus type 1 infection.PMID:27327902
FasL expression in splenic CD5(+)CD1d(hi) B cells was decreased compared to the control group after TLR4 ligation.PMID:28505514
The expression of CD1d showed a significantly negative correlation with CD86 level in B cells from imiquimod (IMQ)-treated mice, B6.MRLlpr mice, and lupus erythematosus (SLE) patients.PMID:28338767
CD1d-restricted peripheral T cell lymphoma in mice and humansPMID:27069116
BCR-ABL-dependent ROCK, but not TK, is involved in CD1d downregulation. We propose that ROCK, which is most likely activated by the DH/PH domain of BCR-ABL, mediates iNKT-cell immune subversion in chronic myeloid leukaemia (CML) patients by downregulating CD1d expression on CML mDCs.PMID:27513300
Importantly, among the analyzed molecules, only CD1d expression showed an association with the activation of double-negative T cells, as well as with worse ventricular function in patients with Chagas disease.PMID:27368347
Data suggest that CD1d antigen-restricted B lymphocytes (Bc) presentation of NGcGM3 drives effective invariant natural killer T cells (iNKT) activation.PMID:26969612
the spatiotemporal distribution of CD1d molecules on the surface of antigen-presenting cells (APCs) modulates activation of Invariant natural killer T cells.PMID:26798067
both membrane-bound (V4) and soluble (V5) isoforms of CD1d were over-expressed in gastric tumor tissues, suggesting that they are involved in anti-tumor immune responses.PMID:26119195
This suggests that CD1D is more polymorphic than previously assumedPMID:26041373
by controlling a fundamental step in CD1d-mediated lipid antigen presentation, STAT3 signalling promotes innate immune responses driven by CD1dPMID:26260288
CD1d acts as a cell surface receptor that recognizes and binds oxysterols and initializes a pathway connecting oxysterol binding to PPARgamma activationPMID:25618030
Using diffraction-based dotReadytrade mark immunoassays, the present study showed that staphylococcal enterotoxin B directly and specifically conjugated to CD1d.PMID:25649790
High CD1d expression is associated with medulloblastomas.PMID:25115738
our results demonstrate that both Ets1 and miR-155 can directly regulate the expression of CD1d on B-cellsPMID:25929465
Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression.PMID:25878107
simplexide, apart from activating iNKT cells, induces the production of cytokines and chemokines from human monocytes by direct interaction with CD1dPMID:25390653
CD1d expression in renal cell carcinoma correlated with aggressive disease and poorer clinical outcomes.PMID:25477528
These findings highlight how components from alphabeta and gammadeltaTCR gene loci can recombine to confer antigenic specificity.PMID:25452463
Expression of CD1d on B cells is suggestive of the ability of these cells to present antigens to, and form cognate interactions with, invariant natural killer T-Cells. (Review)PMID:25381357
We suggest that unique set of interactions between CEACAM5, CD1d, and CD8 render CD1d more class I-like molecule, facilitating antigen presentation and activation of CD8(+)-suppressor regulatory T cells.PMID:24104458
Data indictate variable expression of CD1d on chronic lymphocytic leukemia (CLL)lymphocytes and an association between high expression of CD1d with shorter time to treatment and overall survival of patients.PMID:23668820
results showed the interaction between endoplasmic reticulum (ER)- lumenal domain of HCMV US2 and alpha3 domain of hCD1d was observed within ER; these results show the function of HCMV US2 in immune evasive mechanisms against anti-viral immunity of invariant NKT cellsPMID:24213674
CXCL16, iNKT cell-associated cell marker Valpha24, and CD1d were significantly upregulated in esophageal biopsies from EoE patients and correlated with the expression of inflammatory mediators associated with allergy.PMID:24513807
Relationship between high CD1d expression and shorter time to treatment and overall survival in chronic lymphocytic leukemia. CD1d expression in individual patients significantly changed over time.PMID:24418751
MHC class I physically associates with CD1d and regulates its functional expression on the cell surface.PMID:24009709
these results provide new insight into the control of CD1d gene expression, and they have implications for the evolution of CD1d and type I NKT cells.PMID:24307737
CD1d was found selectively expressed on the surface of hepatocytes in chronic hepatitis C, but not those subjects with history of alcohol usage or resolved chronic hepatitis C.PMID:23808994
The gamma-delta TCR docked orthogonally, over the A' pocket of CD1d, in which the Vdelta1-chain, and the germ line-encoded CDR1d loop, dominated interactions with CD1d.PMID:24076636
our findings strongly suggest that T322 and S323 form a dual residue motif that can regulate the functional expression of CD1d during a viral infection.PMID:23710894
Total CD1d levels are upregulated in pollen lipid-treated dendritic cells, which are then able to activate invariant natural killer (NK)T cells through a CD1d-dependent pathway.PMID:23265858
Type II NKT cells are absolutely dependent on CD1d expression in the thymus for their selection. CD1d trafficks between the cell surface & endosomes. It plays a role in presentating lipid antigens & mycobacterial antigens. Review.PMID:23468111
A novel, autoreactive, CD1d-restricted, GPI-specific T-cell population, enriched in an invariant TCRalpha chain, is expanded in paroxysmal noctural hemoglobinuria and may be responsible for bone marrow failure.PMID:23372165
Antigen presentation of keratinocyte to invariant killer cells show that these cells do not activate the cytotoxicity effector genes in resting iNKT-cells, but had the capacity to serve as targets for activated iNKT-cells dependent on CD1d expression.PMID:23171451
CD1d protein structure determines species-selective antigenicity of isoglobotrihexosylceramide (iGb3) to invariant NKT cells.PMID:23280365
A correlation between CD1d expression (a negative prognostic marker) and the soluble CTLA-4 in B-ALL patients was observed.PMID:23049754
crystallographic and biophysical analyses of alpha-galactosylceramide (alpha-GalCer) recognition by a human CD1d-restricted TCRPMID:23109910
Recombinant Vdelta1 TCRs from different individuals were shown to bind recombinant CD1d-sulfatide complexes in a sulfatide-specific manner.PMID:22829134
Human and mouse type I natural killer T cell antigen receptors exhibit different fine specificities for CD1d-antigen complexPMID:22995911
The binding of Sp1 to CD1d promoter and histone H3 acetylation on Sp1 sites were increased by histone deacetylase inhibitors.PMID:22419072
These findings provide insight into how lysophospholipids are presented by human CD1d molecules and how this complex is recognized by some, but not all, human Invariant Natural Killer T cells.PMID:22395072
Enhancing immunostimulatory function of human embryonic stem cell-derived dendritic cells by CD1d overexpression.PMID:22407918
Defective B cell-mediated stimulation of iNKT cells in SLE patients was associated with altered CD1d recycling.PMID:22406267
The serine-containing variant showed the strongest CD1d binding, offering an explanation for its predominance in vivo.PMID:21956730
CD1d appears to modulate some metabolic functions through an iNKT-independent mechanismPMID:21980475
phenyl glycolipids showed greater binding avidity and stability for iNKT T-cell receptor when complexed with CD1dPMID:21987790
These findings provide the basis for investigations into a role for CD1d in lung mucosal immunity.PMID:21853044
Show
More
Hide
All
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Basolateral cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed on cortical thymocytes, on certain T-cell leukemias, and in various other tissues.