Home
Product
Protein
Transmembrane Proteins
Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP),Nanodisc

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP),Nanodisc

CSB-CF846640HUb1-N

Rate （N/A）
Review （0）

Size:

20ug100ug

US$1820

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

ADTRP

Uniprot NO.

Q96IZ2

Research Area

Others

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-230aa

Target Protein Sequence

MTKTSTCIYHFLVLSWYTFLNYYISQEGKDEVKPKILANGARWKYMTLLNLLLQTIFYGVTCLDDVLKRTKGGKDIKFLTAFRDLLFTTLAFPVSTFVFLAFWILFLYNRDLIYPKVLDTVIPVWLNHAMHTFIFPITLAEVVLRPHSYPSKKTGLTLLAAASIAYISRILWLYFETGTWVYPVFAKLSLLGLAAFFSLSYVFIASIYLLGEKLNHWKWGDMRQPRKKRK

Mol. Weight

31.8 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

Recombinant Human Androgen-dependent TFPI-regulating protein (ADTRP),Nanodisc

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Hydrolyzes bioactive fatty-acid esters of hydroxy-fatty acids (FAHFAs), but not other major classes of lipids. Show a preference for FAHFAs with branching distal from the carboxylate head group of the lipids. Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).

Gene References into Functions

These data suggest that one molecular mechanism by which androgen confers protection against coronary artery disease is stimulation of ADTRP expression. PMID:28645652
ADTRP positively regulates PIK3R3 expression, which leads to activation of AKT and up-regulation of MIA3/TANGO1, thereby regulating endothelial cell functions directly relevant to atherosclerosis. PMID:28341552
ADTRP increases the number of S phase cells during cell cycle. PMID:27235449
These results indicate that AIG1 and ADTRP are founding members of an evolutionarily conserved class of transmembrane threonine hydrolases involved in bioactive lipid metabolism. PMID:27018888
association of ADTRP with the pathogenesis of early-onset CAD PMID:26375920
SNP rs6903956 associated with asymptomatic hyperuricemia susceptibility in Han Chinese PMID:25928384
Activation of PPARG increases the expression of C6ORF105 in human macrophages and atherosclerotic lesions. PMID:25595457
ADTRP polymorphism is associated with the development of coronary atherosclerosis. PMID:24573017
The single nucleotide polymorphism rs6903956 within the ADTRP gene on chromosome 6p24.1 is significantly associated with coronary artery disease in different ethnic groups of the Singaporean population. PMID:23337689
This study confirms ADTRP expression and colocalization with TFPI and caveolin-1 in endothelial cell. PMID:21868574