SVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECK YIEHLEAVTCKCQQEYFGERCGEK
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Ligand of the EGF receptor/EGFR. Autocrine growth factor as well as a mitogen for a broad range of target cells including astrocytes, Schwann cells and fibroblasts.
Gene References into Functions
Amphiregulin contained in non-small-cell lung carcinoma-derived exosomes induces osteoclast differentiation through the activation of EGFR pathway.PMID:28600504
The studies indicate that HIF2-alpha induces myocardial AREG expression in cardiac myocytes, which increases myocardial ischemia tolerance.PMID:29483579
AREG mediates hCG-induced StAR expression and progesterone production in human granulosa cells, providing novel evidence for the role of AREG in the regulation of steroidogenesis.PMID:27113901
Regulatory T-cell-intrinsic amphiregulin is dispensable for suppressive function.PMID:27040371
No significant correlations emerged for YAP or AREG expression and VIII CN schwannoma volume.PMID:28430338
Cullin 3 regulates ADAM17-mediated ectodomain shedding of AREG.PMID:29550478
over-expression of AREG could serve as a novel GC biomarker, and active surveillance of its expression could be a novel approach to GC diagnosis and monitoring.PMID:27713123
Sprouty2 inhibits amphiregulin-induced down-regulation of E-cadherin and cell invasion in human ovarian cancer cells.PMID:27835572
Results show that AREG expression is up-regulated in gastric tumor and its co-expression with TROP2 protein is associated with TNM stage, tumor size, lymph node metastases, and distant metastases.PMID:28256068
secretion of IL-13 and amphiregulin suggests Intrahepatic Innate lymphoid cells may be recruited to promote resolution and repair and thereby they may contribute to ongoing fibrogenesis in liver disease.PMID:29261670
EGF-AREG interplay in airway basal cell stem/progenitor cells is one of the mechanisms that mediates the interconnected pathogenesis of all major smoking-induced lesions in the human airway epithelium.PMID:27709733
AREG expression may be useful for identifying CRTC1-MAML2-positive mucoepidermoid carcinomas and as a marker for favorable prognosis.PMID:27393417
Amphiregulin enhances VEGF-A production in human chondrosarcoma cells and promotes angiogenesis by inhibiting miR-206 via FAK/c-Src/PKCdelta pathway.PMID:27826039
Amphiregulin plays an important role in lung neoplasm resistance to amrubicinolPMID:28476786
EREG and AREG are strongly regulated by methylation, and their expression is associated with CIMP status and primary tumour site.PMID:27272216
These findings demonstrate the posttranslational regulation of Foxp3 expression by AREG in cancer patients through AREG/EGFR/GSK-3beta signaling, which could lead to Foxp3 protein degradation in Treg cells and a potential therapeutic target for cancer treatment.PMID:27432879
blocking soluble amphiregulin with a neutralizing antibody also significantly increased apoptotic cell death of HepG2 cells due to treatment with methyl methanesulfonate, cisplatin, or a recombinant p53 adenovirus, suggesting that the function of amphiregulin involved in inhibiting apoptosis may be a common mechanism by which hepatoma cells escape from stimulus-induced apoptosisPMID:28351301
keratinocyte expression of hAREG elicits inflammatory epidermal hyperplasiaPMID:26519132
Low AREG expression is associated with gastric cancer.PMID:26884344
RYR2, PTDSS1 and AREG are autism susceptibility genes that are implicated in a Lebanese population-based study of copy number variations in this disease.PMID:26742492
High Amphiregulin enhances intercellular adhesion molecule-1 expression and promotes tumor metastasis in osteosarcoma.PMID:26503469
results demonstrate that AREG controls G2/M progression and cytokinesis in keratinocytes via activation of a FoxM1-dependent transcriptional program, suggesting new avenues for treatment of epithelial cancerPMID:26234682
High expression of amphiregulin is associated with hepatocellular carcinoma.PMID:26451607
Findings show the involvement of amphiregulin and semaphorin-3A in the improvement of skin innervations and penetration of nerve fibers into the epidermis.PMID:26201903
Altered AREG expression induced by diverse luteinizing hormone receptor reactivity in granulosa cells may provide a useful marker for oocyte developmental competencyPMID:25911599
Amphiregulin enhances alpha6beta1 integrin expression and cell motility in human chondrosarcoma cells through Ras/Raf/MEK/ERK/AP-1 pathway.PMID:25825984
Our findings implicate amphiregulin as a critical mediator of the estrogen response in ERalpha-positive breast cancerPMID:26527289
AR induces hHSC fibrogenic activity via multiple mitogenic signaling pathways, and is upregulated in murine and human NASH, suggesting that AR antagonists may be clinically useful anti-fibrotics in NAFLD.PMID:25744849
Bradykinin (BK) stimulation of human airway smooth muscle cell increases amphiregulin secretion in a mechanism dependent on BK-induced COX-2 expression.PMID:26047642
The applied drugs showed remarkable suppression of mTOR expression, which might delay tumor progression. Interestingly, sorafenib and sunitinib increased AREG in HNSCC 11A and 14CPMID:25862847
Expression profiling demonstrated that AREG-activated EGFR regulates gene expression differently than EGF-activated EGFRPMID:25454348
This study shows that TGF-alpha uses common and divergent molecular mediators to regulate E-cadherin expression and cell invasion.PMID:25869072
AREG rs1615111, located in the AREG genomic region, can significantly define different prognostic cohorts in locally advanced GCPMID:25203737
AREG induces ovarian cancer cell invasion by down-regulating E-cadherin expressionPMID:25261255
During high-pressure ventilation, Nrf2 becomes activated and induces AREG, leading to a positive feedback loop between Nrf2 and AREG, which involves the p38 MAPK and results in the expression of cytoprotective genes.PMID:24921206
AREG expression was significantly correlated with Edmondson stage and serum AFP level.PMID:24860833
AREG shedding occurs through a TNF-alpha-converting enzyme-dependent mechanism in diacetyl treated pulmonary epithelial cells.PMID:24816162
aberrantly activated AREG-EGFR signaling is required for CRTC1-MAML2-positive MEC cell growth and survival, suggesting that EGFR-targeted therapies will benefit patients with advanced, unresectable CRTC1-MAML2-positive MEC.PMID:23975434
Self-reinforcing loop of amphiregulin and Y-box binding protein-1 contributes to poor outcomes in ovarian cancer.PMID:23851501
IL-1beta-induced amphiregulin release may be involved in the pathogenesis of rheumatoid arthritis.PMID:24196392
These findings provide mechanistic insight into the regulation of YAP and AREG by RASSF1A in human multistep hepatocarcinogenesis.PMID:23594797
Data suggest that AREG (amphiregulin), BTC (betacellulin), and EREG (epiregulin) induced prostaglandin E2 production by induction of COX-2 (prostaglandin-endoperoxide synthase 2) through MAP kinase signaling in granulosa cells.PMID:24092824
Exosome-bound WD repeat protein Monad inhibits breast cancer cell invasion by degrading amphiregulin mRNA.PMID:23844004
Promoter methylation of AREG is associated with glioblastoma.PMID:23624749
AREG plays pro-neoplastic roles in colorectal carcinogenesisPMID:23263765
EREG-AREG and NRG1, which are members of the epidermal growth factor (EGF) family, seem to modulate Behcet's disease susceptibility through main effects and gene-gene interactionsPMID:23625463
we did not find a correlation between the presence of a K-ras mutation and the presence of Epiregulin and Amphiregulin in colon cancer tissue.PMID:23885463
Regulation of amphiregulin gene expression by beta-catenin signaling in human hepatocellular carcinoma cells.PMID:23285165
Human antigen R-mediated mRNA stabilization is required for ultraviolet B-induced autoinduction of amphiregulin in keratinocytes.PMID:23430747
Polycystin-1 regulates amphiregulin expression through CREB and AP1 signalling, which has implications in ADPKD cell proliferationPMID:22570239