MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins.
Gene References into Functions
The frequency of alpha2CDel322-325-AR in suicide and non-suicide victims was similar. Genotype frequencies for the alpha2CDel322-325-AR polymorphism in depressed and schizophrenic subjects were higher than in controls, but these differences did not reach statistical significance. The results indicate that alpha2CDel322-325-AR may play a role in the pathophysiology of opiate abuse and dependence.PMID:27007576
Immunoreactivity for ADRA2C was densely distributed in vascular smooth muscle of nasal turbinates.PMID:26739946
ADRA2c is associated with heart rate recovery after exercise.PMID:26058836
Common polymorphisms in the ADRA2C gene are not associated with orthostatic hypotension risk in Chinese.PMID:26427149
Adrenergic receptor genotype influences heart failure severity and beta-blocker response in children with dilated cardiomyopathy.PMID:25406899
alpha2C-adrenoreceptor interaction with filamin-2PMID:25110951
Genetic variants of ADRA2C do not alter intracellular localization or plasma membrane trafficking.PMID:24643471
the ADRA2C 322-325I/D genotype is a novel genetic risk marker for SBI among individuals with hyperhomocysteinemia.PMID:24676565
the region comprising the N-terminal half of The receptors contributed to the alpha2C-selectivity of drug binding.PMID:23868076
Bucindolol prevents ventricular arrhythmias in subjects with heart failure and reduced left ventricular ejection fractions, and this effect is modulated by adrenergic alpha 2 receptor polymorphisms.PMID:23275278
the predicted signal peptide in the N-terminal tail of the alpha(2C)-adrenoceptor does not act as a cleavable signal peptidePMID:22503931
there is little evidence for an association between alpha(2C)Del322-325 polymorphism and an increased prevalence of left ventricular hypertrophy in patients with systemic hypertension.PMID:22040172
Genotype polymorphism frequencies for B1 receptor (amino acid positions 389 and 49) and alpha 2c receptor (deletion 322-325) are not significantly different in SC patients compared to female controls.PMID:19167638
The alpha(2C)-Del322-325 polymorphism does not exhibit reduced signalling to adenylyl cyclase and may not represent a clinically important phenotype.PMID:20128806
The common ADRA2C variant affected pain perception before and after dexmedetomidine but did not affect other cognitive responsesPMID:19423370
the norepinephrine lowering and clinical therapeutic responses to bucindolol were strongly influenced by alpha(2C) receptor genotypePMID:19880803
Increased expression of alpha(2C)-adrenoceptors may contribute to enhanced cold-induced vasoconstriction and Raynaud's phenomenon.PMID:15345481
ADRA2C had one haplotype block of 10 kbPMID:15592690
alpha2CDel322-325 polymorphism is associated with increased sympathetic nervous and adrenomedullary hormonal activities, both during supine rest and during pharmacologically evoked catecholamine releasePMID:15861038
A genetic variant of the alpha 2C-adrenoceptor subtype--resulting from the deletion of four consecutive amino acids at codons 322-325--confers a change in brain function playing a role in the pathogenesis of major depressive disorder.PMID:16407897
Genetic variations of the alpha and beta adrenergic receptors (alpha 2C Del322-325 allele) were found to be significant predictors of vasospastic anginaPMID:16569551
alpha(2)-ARs might contribute neurotrophic actions in vivo synergistically or in permutation with other neurotrophic factorsPMID:17192578
The ADRA2C deletion polymorphism had no effect on markers of resting sympathetic activity and cardiovascular measures, and did not account for ethnic differences in blood pressure.PMID:17351367
An estrogen-dependent increase in expression of cold-sensitive alpha(2C)-ARs may contribute to the increased activity of cold-induced vasoconstriction under estrogen-replete conditionsPMID:17644575
Homozygosity for the alpha 2C Del322-325 polymorphism is not associated with heart failure in black South AfricansPMID:18320080
Because the alpha(2C)-adrenoceptor distribution pattern is conserved between rodents and humans, studies on the role of the alpha(2C)-adrenoceptor in rodent models of neuropsychiatric disorders may be relevant also for human diseases.PMID:18435421
Cyclic AMP acts through Rap1 and JNK signaling to increase expression of cutaneous smooth muscle alpha2C-adrenoceptors.PMID:18487435
Genetic variants in the alpha2C-adrenoceptor and G-protein contribute to ethnic differences in cardiovascular stress responsesPMID:18698227
Genotype and haplotype of ADRA2C did not significantly affect survival in metoprolol-treated or carvedilol-treated heart failure patients.PMID:18702968
Beta1- and alpha2c-adrenoreceptor variants as predictors of clinical aspects of dilated cardiomyopathy in people of African ancestry.PMID:18776959
Our findings provide important evidence that the ADRA2C polymorphism is involved in the etiology of ADHD in Korean subjects.PMID:18835330
Three polymorphisms in ADRA2C and five polymorphisms in ADRB1 were involved in eight cross-validated epistatic interactions identifying several two-locus genotype classes with significant relative risks of death/transplant in heart failure patientsPMID:18947427
The ADRA2C del322-325 variant did not affect vascular sensitivity to local cold exposure.PMID:19444546