MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS LNPVIYTIFNQDFRRAFRRILCRPWTQTAW
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Alpha-2 adrenergic receptors mediate the catecholamine-induced inhibition of adenylate cyclase through the action of G proteins. The rank order of potency for agonists of this receptor is clonidine > norepinephrine > epinephrine = oxymetazoline > dopamine > p-tyramine = phenylephrine > serotonin > p-synephrine / p-octopamine. For antagonists, the rank order is yohimbine > chlorpromazine > phentolamine > mianserine > spiperone > prazosin > alprenolol > propanolol > pindolol.
Gene References into Functions
An exaggerated vasoconstriction response to dexmedetomidine, an alpha-2 adrenergic agonist, has been associated with deletion in the alpha-2B adrenoreceptor gene (ADRA2B deletion).PMID:28482761
Data indicate an association of arterial stiffness and platelet alpha2B-Rs gene expression.PMID:28923554
full length alpha2B-AR associated with GGA2 but not GGA1, its third intracellular loop was found to directly interact with both GGA1 and GGA2. More interestingly, further mapping of interaction domains showed that the GGA1 hinge region and the GGA2 GAE domain bound to multiple subdomains of the loop.PMID:27901063
The ADRA2B DD genotype was associated with Hypertension and was more common in the native population of Mountain Shoria (Siberia).PMID:29039833
stress administered immediately before learning selectively enhanced long-term recall in ADRA2B deletion carriers. Stress administered 30min before learning impaired recognition memory in male deletion carriers, while enhancing recognition memory in female deletion carriers.PMID:28254464
This study demonstrated that a deletion variant of the ADRA2B gene encoding the alpha2b-adrenoceptor reduces the stress-induced shift from hippocampal cognitive toward dorsal striatal habit memory.PMID:28115477
These results identify a beta2-adrenergic-Ca(2+)-actin axis as a new regulator of cell deformability.PMID:27875276
ADRA2B SNPs were associated with myocardial infarction susceptibility, blood pressure and plasma lipids.PMID:28456594
These findings suggest that deletion variants of ADRA2B may show greater levels of cognitive-affective flexibility compared to non-carriers.PMID:26899992
role of GGA3 in the cell surface export of alpha2B-adrenergic receptorPMID:26811329
Common polymorphisms in the ADRA2B gene are not associated with orthostatic hypotension risk in Chinese.PMID:26427149
norepinephrine-related neurogenetic differences enhance the subjective vividness of perceptual experience and its emotional enhancement.PMID:25904801
The results of this study suggested that ADRA2B is closely related to the individual difference in human attention orientation, but not to the individual difference in emotional processing.PMID:25325286
ADRA2B deletion carriers showed decreased neural activity in the amygdala when recognizing emotional faces in control condition and increased amygdala activity under stress.PMID:25127926
The ADRA2B deletion variant may selectively predict stress effects on memory in females.PMID:24997351
Polymorphism DD of a gene ADRA2B is a genetic predictor of predisposition to the blockade of the right and left bundle branch block.PMID:25558682
Carrying the ADRA2B deletion variant enhances the relationship between arousal at encoding and subsequent memory for moderately arousing events.PMID:24149058
ADRA2B mutations are associated with emotional subjectivity of viusal perception.PMID:24058067
The ADRA2b deletion variant, which was previously associated with vasoconstriction, to emotional memory and visual perception.PMID:24269973
A mutation in alpha2B-adrenergic receptor is associated with autosomal dominant cortical myoclonus and epilepsy.PMID:24114805
Carriers of the ADRA2B functional deletion variant showed an impaired recognition and slower retrieval of neutral faces under stress.PMID:23583499
Statistically significant prevalence of homozygous genotype DD of ADRA2B gene was found in patients with atrioventricular blocks and sick sinus node syndrome.PMID:24087960
this study demonstrated for the first time an independent contribution of the ADRA2B genetic polymorphism to memory impairment and we further suggest a possible protective role of the deletion variant against the disease development.PMID:23499426
Adenosine alpha2B receptor is upregulated in the peripheral blood leukocytes of multiple sclerosis patients.PMID:23225885
Molecular dynamics simulations of palmitoylated/glycosylated, membrane-integrated human A(2B)AR in its native environment is a possible approach and this model can be used for designing potent and selective A(2B)AR antagonists.PMID:22570080
There were no main effects or interactions in relation to ADRA2B genotype.PMID:21965191
The significant novel finding from this study is that the affective modulation of T2 detection is influenced by a non-additive (epistatic) interaction between the ADRA2B and 5-HTTLPR insertion/deletion polymorphisms.PMID:21854681
Adenosine A(2B) receptor signaling plays a role in regulating placental 11beta-hydroxysteroid dehydrogenase type 2 expression, and consequently fetal development.PMID:22701600
Activation of the adenosine A(2B) receptor protects against vascular injury, while it also enhances plaque stability as indicated by increased collagen content.PMID:22743060
A triple arg motif mediates alpha(2B)-adrenergic receptor interaction with Sec24C/D and exportPMID:22404651
For the first time, we revealed on clinical - genetic material association between hereditary disturbances of cardiac conduction and polymorphism of 2-adrenergic receptor gene.PMID:22839581
this study found significant effects of ADRA2B haplotype polymorphisms on response inhibition in a large Chinese sample, with the minor AAGG haplotype associated with shorter SSR.PMID:22218095
Data strongly demonstrate that the small GTPase ARF1 modulates ERK1/2 activation by alpha(2B)-AR and provide the first evidence indicating a novel function for ARF1 in regulating the MAPK signaling pathway.PMID:22025613
the ADRA2B polymorphism influences emotional memory formation but not memory retrieval in the amygdala and left inferior frontal gyrus.PMID:21259387
The noradrenaline-mediated depolarization of vascular smooth muscle cells is produced by activation of both alpha(1)-and alpha(2)-adrenoceptors.PMID:20739228
Was detected polymorphisms of ADRA2B in patients with atrial fibrillation.PMID:21942960
ADRA2B gene polymorphism might be associated with the hereditary sick sinus node syndrome.PMID:21878072
Data do not show any association between the presence of the alpha2B-adrenergic receptor deletion allele and the occurrence of spontaneous abortions.PMID:21159032
Alpha2B-adrenergic receptor interaction with tubulin controls its transport from the endoplasmic reticulum to the cell surfacePMID:21357695
gene x exercise interactions were observed for A2BGlu9/12 and B2Gln27Glu on change in lean soft tissue (LST, p = 0.02); exercisers on the A2BGlu9- background gained LST compared to a loss among controls over 12 months (p\0.05)PMID:20401689
Homozygote for insertion [I]/deletion allele of alpha(2B)-AR gene polymorphism is associated with silent myocardial ischemia in type 2 diabetes mellitus patients with coronary artery disease.PMID:20692245
the findings of this study do not support a functional significance of ADRA2B indel polymorphism at position -4825 relative to the start codon in the far upstream region of the promoter in the present migraine subjects.PMID:20651814
Data provide strong evidence indicating that Rab8 GTPase interacts with distinct motifs in the C termini of alpha(2B)-AR and beta(2)-AR and differentially modulates their traffic from the TGN to the cell surface.PMID:20424170
carriage of the ADRA2B deletion abolished the relative memory impairment in homozygous COMT val158 carriers compared to met158 carriers.PMID:20110158
The ADRA2B 301-303 deletion allele (ins/del and del/del, n = 18) was associated with resistance to desensitization.PMID:20051907
Middle-aged white men carrying the DD genotype of the alpha(2B)-AR have a significantly increased risk for sudden cardiac death and myocardial infarction, especially before the age of 55 years.PMID:12535806
No major functional significance of the alpha(2B) adrenergic receptor polymorphism in the present sample of morbidly obese subjects was found.PMID:12822042
A polymorphism in the (alpha)2B adrenoceptor gene associates with hypertension.PMID:14744925
body fat response to exercise training in older adults is associated with the combined effects of the Glu12/Glu9 alpha2b-adrenergic receptor, Trp64Arg beta3-adrenergic receptor, and Gln27Glu beta2-adrenergic receptor gene variantsPMID:15166301
The 12Glu9 polymorphism of ADRA2B is associated with impaired insulin secretion and may predict the development of Type 2 diabetes.PMID:15309292