MTFRDLLSVSFEGPRPDSSAGGSSAGGGGGSAGGAAPSEGPAVGGVPGGAGGGGGVVGAG SGEDNRSSAGEPGSAGAGGDVNGTAAVGGLVVSAQGVGVGVFLAAFILMAVAGNLLVILS VACNRHLQTVTNYFIVNLAVADLLLSATVLPFSATMEVLGFWAFGRAFCDVWAAVDVLCC TASILSLCTISVDRYVGVRHSLKYPAIMTERKAAAILALLWVVALVVSVGPLLGWKEPVP PDERFCGITEEAGYAVFSSVCSFYLPMAVIVVMYCRVYVVARSTTRSLEAGVKRERGKAS EVVLRIHCRGAATGADGAHGMRSAKGHTFRSSLSVRLLKFSREKKAAKTLAIVVGVFVLC WFPFFFVLPLGSLFPQLKPSEGVFKVIFWLGYFNSCVNPLIYPCSSREFKRAFLRLLRCQ CRRRRRRRPLWRVYGHHWRASTSGLRQDCAPSSGDAPPGAPLALTALPDPDPEPPGTPEM QAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVE AVSLGVPHEVAEGATCQAYELADYSNLRETDI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
This alpha-adrenergic receptor mediates its effect through the influx of extracellular calcium.
Gene References into Functions
Hetero-oligomerization of a1B/D-adrenergic receptor with the chemokine (C-X-C motif) receptor 4:atypical chemokine receptor 3 heteromeric complex is required for a1B/Dadrenergic receptor function.PMID:28862946
processing of the ADRA1D NT domain is a physiological mechanism employed by cells to generate a functional ADRA1D isoform with optimal pharmacodynamic properties.PMID:27382054
expression of carboxyl terminus-truncated alpha1D-adrenoceptors alters ERK and p38 phosphorylation state.PMID:27146292
Immunoreactivity for ADRA2D was densely distributed in submucosal glands of nasal turbinates.PMID:26739946
In conclusion, our work clarified some cellular aspects promoted by alpha1D-AR activity modulation and supports a further pharmacological approach in the cure of hormone-refractory PC, by targeting specifically this AR subtypePMID:26621245
This study showed that ADRA1D gene involved in neuronal growth and cerebellum development and associated with neurological and psychological disorders.PMID:26381449
alpha1A-adrenergic receptors are stably expressed and stimulate cell migration and TGF-beta1, IGF-1, hyaluronan and PIP production in human skin fibroblasts.PMID:24844469
Cross-talk between alpha1D-adrenoceptors and transient receptor potential vanilloid type 1 triggers prostate cancer cell proliferation.PMID:25481381
Mean alpha-receptor stain rates in renal pelvis were 2.65 +/- 0.74, 1.35 +/- 0.81 and 2.9 +/- 0.30 for alpha 1A, 1B and 1D, respectively. For calyces, the rates are 2.40 +/- 0.82, 1.50 +/- 0.76 and 2.75 +/- 0.44 for alpha 1A, 1B and 1D, respectively.PMID:23877383
alpha(1)(D)-adrenoceptors in the lower urinary tract might play an important role in the pathophysiology of lower urinary tract disorders. [review]PMID:23205498
Data show that alpha-dystrobrevin-1 recruits alpha-catulin, which supersensitizes alpha(1D)-AR functional responses by recruiting effector molecules to the signalosome.PMID:21115837
Genetic characteristics associated with response to domperidone therapy included polymorphisms in the drug transporter gene ABCB1, the potassium channel KCNH2 gene, and alpha1D--adrenoceptor ADRA1D gene.PMID:21063774
Data show thah activation of alpha(1)A- or alpha(1)B-adrenergic receptors inhibits serum-promoted cell proliferation, whereas alpha(1)D-AR activation does not show such an inhibitory effect.PMID:12409310
These studies suggest that gC1qR interacts specifically with alpha1B- and alpha1D-, but not alpha1A-ARs, and this interaction depends on the presence of an intact C-tail.PMID:14626446
cell surface expression of alpha1D-adrenergic receptors is controlled by heterodimerization with alpha1B-adrenergic receptorsPMID:14736874
alpha(1A)- and alpha(1D)-adrenergic receptors mediate G(1)-S cell-cycle arrestPMID:15297446
Human ureter was endowed with each alpha1 AR subtype, although alpha1D and alpha1A ARs were prevalent over alpha1B ARs.PMID:15690361
alpha1D-adrenergic receptors are regulated by syntrophins through a PDZ domain-mediated interactionPMID:16533813
Differential methylation of proximal GC boxes in the ADRA1D promoter disrupts Sp1 binding in a cell-specific manner resulting in repression of basal alpha1dAR expression.PMID:17384146
ADRA1D polymorphisms are predictive markers of the response to beta-blockersPMID:17404580
Stimulation of alpha(1D)-ARs by picomolar phenylephrine concentrations devoid of any contractile vascular effects, induces a proangiogenic phenotype in endothelial cells that is enhanced in a hypoxic environment.PMID:17660397
In the proximal and medial ureter, the distribution of ARs was alpha 1d > or = alpha 1a > alpha 1b; In the distal ureter, the distribution of ARs was alpha 1d > alpha 1a > alpha 1bPMID:17681068
expression in distal ureter higher than in proximal and mid ureter but not statistically significantPMID:17973108
Investigate role of ADRA1D amino residues in binding of beta-adrenergic antagonists (prazosin/tamulosin).PMID:18187928
ADRA1A expression was decreased in end stage renal disease. Functional receptor changes mediated vascular hypersensitivity to phenylephrine.PMID:18257748
ADRA1D induces vascular smooth muscle apoptosis via a p53-dependent mechanism.PMID:18628404
Our data indicate that carboxyl terminus-truncated alpha(1D)-adrenoceptors are fully functional and subjected to regulation by phosphorylation. The roles of the carboxyl termini differ among alpha(1)-adrenoceptor subtypes.PMID:19458937