EGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETGNIWTHLLGFVLFLFLGILTMLRPNMYFMAPLQEKVVFGMFFLGAVLCLSFSWLFHTVYCHSEKVSRTFSKLDYSGIALLIMGSFVPWLYYSFYCSPQPRLIYLSIVCVLGISAIIVAQWDRFATPKHRQTRAGVFLGLGLSGVVPTMHFTIAEGFVKATTVGQMGWFFLMAVMYITGAGLYAARIPERFFPGKFDIWFQSHQIFHVLVVAAAFVHFYGVSNLQEFRYGLEGGCTDDTLL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.8 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-Flag-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from Tris/PBS-based buffer, 6% Trehalose
Receptor for ADIPOQ, an essential hormone secreted by adipocytes that regulates glucose and lipid metabolism. Required for normal glucose and fat homeostasis and for maintaining a normal body weight. ADIPOQ-binding activates a signaling cascade that leads to increased AMPK activity, and ultimately to increased fatty acid oxidation, increased glucose uptake and decreased gluconeogenesis. Has high affinity for globular adiponectin and low affinity for full-length adiponectin.
Gene References into Functions
Upregulation of ADIPOR1 and SPP1, among the adipokine gene family, in cancer tissue is associated with poor survival in CRC, suggesting a potential mechanism linking obesity and colorectal cancer.PMID:29761507
ADIPOR1 was consistently associated with diabetes and hypertriglyceridemia in an admixed Latin American population.PMID:29145541
miR-221 acts as a promoter of the EMT process in HCC cells by targeting AdipoR1PMID:28539268
The pathways related to tumorigenicity and tumor progression, STAT2 and AdipoR1/AMPK/SIRT1 could be restrained by miR-3908. In conclusion, restoration of miR-3908 expression induced suppression of cancer progression and glioblastoma tumorigenicity.PMID:28440504
Review/Meta-analysis: genetic polymorphisms in leptin, adiponectin and their receptors affect the development and progression of prostate cancer.PMID:27768592
Renoprotection of adiponectin is associated with improvement of the endothelial dysfunction, reduction of oxidative stress, and upregulation of endothelial nitric oxide synthase expression through activation of adenosine 5'-monophosphate-activated protein kinase by AdipoR1 and activation of peroxisome proliferator-activated receptor (PPAR)-alpha signaling pathway by AdipoR2. [review]PMID:28402446
High ADIPOR1 expression is associated with breast cancer.PMID:28327197
revised ADIPOR1 crystal structure exhibiting a seven-transmembrane-domain architecture that is clearly distinct from that of ADIPOR2PMID:28329765
TNF-alpha impairs adiponectin/AdipoR1 signaling, mitochondrial biogenesis, and myogenesis in primary human myotubes cultures obtained from heart failure patients.PMID:26921438
the knockdown phenotype was partially rescued by injecting wild-type, but not mutant, human ADIPOR1 mRNA. We conclude that ADIPOR1 is a novel adRP-causing gene and plays an important role in rod development and maintenance.PMID:27655171
Adiponectin stimulates cPLA2 and COX-2 expression via AdipoR1/2-dependent activation of PKC/NADPH oxidase/mitochondria resulting in ROS accumulation, p300 phosphorylation, and histone H4 acetylation.PMID:27288489
Decreased expression of ADIPOR1 is associated with polycystic ovary syndrome.PMID:27075719
sequence- and structure-based computational tools were employed in this study to functionally and structurally characterize the coding Nonsynonymous Single Nucleotide Polymorphisms of ADIPOR1 gene listed in the single nucleotide polymorphisms database.PMID:27294143
PCR results showed expression of adiponectin, AdipoR1, AdipoR2, follicle-stimulating hormone receptor (FSHR), and luteinizing hormone receptor (LHR) in granulosa cells (GCs). After controlling body mass index (BMI) values, qRT-PCR demonstrated a decreased expression of adiponectin system in GCs of polycystic ovary syndromepatients compared to those in controlsPMID:26631404
ADPOR1 variants, rs3737884*G and rs7514221*C, may be shared risk factors associated with CAD, T2D, and T2D with CAD in a population of northeast China.PMID:26741812
Expression of AdipoR1 gene receptor was increased in endometriotic stromal cells.PMID:26459399
miR-323 may increase VEGF-A-mediated cancer vascularization in PC cells through AdipoR1 suppression.PMID:26160610
We did not find any significant associations with ADIPOR1 gene variants and fasting plasma triglycerides in HIV-infected patients.PMID:26111083
In conclusion, neutrophil AdipoRs (AdipoR1, AdipoR2) upregulation was associated with early stages of vascular injury, hypertension severity, and low serum levels of adiponectinPMID:26146630
The ADIPOR1 rs1342387(G/A) polymorphism, but not rs12733285(C/T) or rs7539542(C/G), may be associated with cancer risk, especially risk of colorectal cancer in Asians.PMID:26047008
Results demonstrate that the non-conserved N-terminal trunks dictate the cell-surface expression and temporal signaling profiles of AdipoR1 and AdipoR2.PMID:25892445
Decreased AdipoR1 mRNA levels and increased circulating adiponectin in advanced stages of coronary artery disease implies that CAD could be related to 'adiponectin resistance'.PMID:25582653
Data indicate the thermal stability of purified N-terminally truncated mutants of adiponectin receptors AdipoR1 and AdipoR2.PMID:25575462
The present data suggest that the disturbed interaction of adiponectin with AMPK is located downstream of the AdipoR1 receptor.PMID:24104889
we not only detected significant decreases in plasma adiponectin levels in prostate cancer patients, but also showed significant decreases in adiponectin receptor I (AdipoR1) levels in the resected prostate cancer specimenPMID:25586350
This study indicated that ApN may play a role in the progression of colorectal adenomatous polyps to carcinoma through actions on adipo-R1 and adipo-R2 receptors.PMID:25640382
crystal structures of the human adiponectin receptors AdipoR1 and AdipoR2 at 2.9 A and 2.4 A resolution, respectivelyPMID:25855295
down-regulation of adiponectin receptors (AdipoR1, R2, and T-cadherin) in osteoarthritic chondrocytesPMID:24888493
Data suggested that variant rs1342387 on ADIPOR1 may be a novel colorectal cancer susceptibility factor but not rs12733285 neither ADIPOQ variants rs266729, rs822395, rs2241766, and rs1501299.PMID:25516230
ADIPOR1 rs1342387 polymorphism is significantly associated with risk of colorectal cancerPMID:25292021
In conclusion, all these observations suggest that adiponectin influences bone metabolism decreasing the levels of bone formation.PMID:24673523
The improvement of insulin sensitivity by physical exercise is related to adiponectin and/or AdipoR1/R2 expression changes.PMID:25126860
uremia results in upregulation of AdipoR1 but adiponectin resistance at the post-receptor level.PMID:25049200
macrophage polarization is a key determinant regulating AdipoR expression and differential APN-mediated macrophage inflammatory responsesPMID:25392268
In those with advanced stage gastric cancer, 7 of 39 had low Adipo-R1 expression (17.9%) and 16 had low Adipo-R2 expression (41%).PMID:24969908
Adiponectin Receptor 1 has a role in reversing imatinib resistance in K562 human chronic myeloid leukemia cellsPMID:25475722
Low ADIPOR1 expression is associated with hepatocellular carcinoma.PMID:24619866
ADIPOR1 risk polymorphisms are a strong candidate for the "common soil" hypothesis and could partially contribute to disease susceptibility to T2D, CAD, and T2D with CAD in the Northern Han Chinese populationPMID:24967709
AdipoR1 stimulates IL10 production by activating the AMPK and MAPKp38 pathways, whereas AdipoR2 modifies inflammatory processes by activating the COX-2 and PPARG pathways.PMID:25261236
SNP rs1539355 in the ADIPOR1 gene is associated with insulin resistance in Chinese PCOS patients.PMID:24335000
Genome-wide expression profiling identified the transcription of ADIPOR1, VAMP3 and C11ORF10 to be correlated with decreased ANRIL expression in a time-dependent manner.PMID:23813974
adiponectin receptors(AdipoR1 and -R2 ) are located, or re-located, in the plasma membrane with distribution in the cytoplasm when mononuclear cells are committed to differentiate to osteoclasts.PMID:23971629
established link between obesity and RCC can therefore be further explained by the adiponectin deficiency in obese individuals together with reduced AdipoR1 protein in RCCPMID:24096711
SNPs of both the adiponectin gene and its receptors AdipoR1 and AdipoR2 (including their haplotypes) appear as candidate genes and involved in the development of the state of insulin resistance.PMID:23656997
ADIPOR1 gene single nucleotide polymorphism (13423870) associated with the increased risk in cardiovascular diseases in patients with nonalcoholic fatty liver diseasePMID:23293232
non-alcoholic fatty liver disease patients, who were carriers of G allele rs6666089 ADIPOR1 had higher levels of visceral, subcutaneous adipose tissue and their relation and percentage of liver fat in comparison with ADIPOR1 A allele carriersPMID:23388528
AdipoR1 and leptin receptor protein levels were significantly higher in Barrett's esophagus patients compared to controls and obese controls.PMID:23756394
these data suggest that AdipoR1 protein levels are regulated by so far uncharacterized class I PDZ proteinsPMID:23860432
SNPs in ADIPOR1 were associated with weight gain in women diagnosed with breast cancer.PMID:23922112
Studies indicate that altered levels of adiponectin and leptin or their cognate receptors in cancers can ultimately lead to an imbalance in downstream molecular pathways.PMID:23355630
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
ADIPOR family
Tissue Specificity
Widely expressed. Highly expressed in heart and skeletal muscle. Expressed at intermediate level in brain, spleen, kidney, liver, placenta, lung and peripheral blood leukocytes. Weakly expressed in colon, thymus and small intestine.