MLLETQDALYVALELVIAALSVAGNVLVCAAVGTANTLQTPTNYFLVSLAAADVAVGLFA IPFAITISLGFCTDFYGCLFLACFVLVLTQSSIFSLLAVAVDRYLAICVPLRYKSLVTGT RARGVIAVLWVLAFGIGLTPFLGWNSKDSATNNCTEPWDGTTNESCCLVKCLFENVVPMS YMVYFNFFGCVLPPLLIMLVIYIKIFLVACRQLQRTELMDHSRTTLQREIHAAKSLAMIV GIFALCWLPVHAVNCVTLFQPAQGKNKPKWAMNMAILLSHANSVVNPIVYAYRNRDFRYT FHKIISRYLLCQADVKSGNGQAGVQPALGVGL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Receptor for adenosine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.
Gene References into Functions
CD73-depedent elevation of plasma adenosine signaling via ADORA2B-mediated protein kinase A phosphorylation, ubiquitination and proteasome degradation of erythrocyte ENT1 is a novel feed-forward signaling network underlying initial hypoxic adaptation and retention upon re-exposure.PMID:28169986
hypoxia increased expression of adenosine receptor 2B (A2BR) in human breast cancer cells through the transcriptional activity of hypoxia-inducible factor 1.PMID:30242135
findings suggest that hypoxia, through HIF1A, contributes to the development and progression of pulmonary fibrosis through its regulation of ADORA2B expression on alternatively activated macrophages, cell differentiation, and production of profibrotic mediatorsPMID:28701304
The A2b adenosine receptor antagonist PSB-603 promotes oxidative phosphorylation and ROS production in colorectal cancer cells via adenosine receptor-independent mechanism.PMID:27693637
the effects of TNF-alpha were investigated on the expression/responsiveness of the A2B adenosine receptor (A2BAR), a Gs-coupled receptor that promotes mesenchymal stem cell (MSC) differentiation into osteoblasts.PMID:28137910
cells lacking A2b do not respond in this manner to hypoxia or ATP but transfection of A2b restores this response, that Epac1 is critically involved, and that Rap1B is important for the relative positioning of the centrosome and nucleus.PMID:27226580
Studies show that A2b receptor is overexpressed in various tumor lines and biopsies from patients with different cancers. This suggests that A2b receptor can be used by tumor cells to promote progression. [review]PMID:27729268
Findings suggest that, in obese status, the lower expression level of A2bAR, KLF4, and KLF15 of visceral adipose tissue may correlate with obese-dyslipidemia induced inflammation in Uygur population.PMID:27199507
erythrocyte AMP-activated protein kinase was activated in humans at high altitude. It is a key protein functioning downstream of the A2B adenosine receptor, phosphorylating and activating BPG mutase and thus inducing 2,3-BPG production and O2 release from erythrocytes.PMID:27482003
A2B receptor activation is critically required for the stimulatory effect of adenosine on IL-10 production and suppression of nitric oxide release.PMID:26748211
Data show that ADORA2B mRNA and protein were significantly up-regulated in oral squamous cell carcinoma (OSCC) and that ADORA2B controls cellular proliferation via HIF-1alpha activation, suggesting it may be a key regulator of tumoral progression in OSCCs.PMID:26228921
ADORA2B is a target gene of miR-128b.MiR-128b represses cell proliferation, migration and invasion and promotes apoptosis by targeting ADORA2B in gastric cancer.PMID:26478435
the A2B AR activation-driven angiogenesis via cAMP-PKA-CREB mediates VEGF production and PI3K/AKT-dependent upregulation of eNOS in HMEC-1PMID:25966978
The rs7208480 of ADORA2B as well as the haplotypes were not found to be associated with chronic heart failure susceptibility.PMID:25629231
our data suggest that adenosine A2b signaling represses CIITA transcription in VSMCs by manipulating the interaction between STAT1 and the epigenetic machinery.PMID:25765819
After myocardial infarction, A2B receptor signaling regulates myocardial repair and remodeling.PMID:24584483
Activation of the adenosine A2B receptor is regulated by the C-terminus of G protein alpha-subunits.PMID:24464644
the adenosine A2b receptor was shown to be the only one of the adenosine receptors whose cardiac expression is induced by ischemia in both mice and humans and whose function is implicated in ischemic pre- or post-conditioningPMID:24502579
A2B receptor activation blunts trophoblast migration possibly as a result of reduced activation of the MAPK signaling pathway and lower proMMP-2 levels.PMID:25002363
the A2B adenosine receptor (ADORA2B) is essential for adenosine-induced SphK1 activity in human and mouse normal and sickle erythrocytes in vitroPMID:25587035
Findings support a potentially destructive role for A2BAR under intestinal ischemia/reperfusion and acute hypoxic conditions.PMID:24966910
study implicates the A2bAR as a regulator of adipocyte differentiation and the A2bAR-KLF4 axis as a potentially significant modulator of adipose biology.PMID:24928509
HUVECs from preeclampsia exhibit elevated protein level of A2BAR and impairment of A2BAR-mediated NO/VEGF signaling pathway.PMID:24877077
Data indicate adenosine receptor ADORA2B as the specific receptor and signalling pathway for the metabolite 5'-methylthioadenosine (MTA).PMID:25087184
High concentrations of extracellular adenosine in the tumor microenvironment can chronically activate A2B receptors to suppress Rap1B prenylation and signaling at the cell membrane, resulting in reduced cell-cell contact and promoting cell scattering.PMID:23716716
ADORA2B was induced in lung cells after cyclic mechanical stress. A prominent region within the ADORA2B promoter conveys stretch responsiveness and has a binding site for HIF-1.PMID:24391213
an important role of the A2B receptor-dependent upregulation of JunB in VEGF production and possibly other AP-1-regulated events.PMID:24136993
increased expression levels of the adenosine A2B receptor and a heightened deposition of hyaluronan (a component of the extracellular matrix) in remodeled vessels of patients with pulmonary hypertension associated with COPDPMID:23855769
Hypoxia induced serotonin synthesis and secretion is amplified by ADORA2B signaling via MAPK/CREB and TPH-1 activation.PMID:23638125
CD73 promotes the production of renal adenosine that is a prominent driver of renal hypertension by enhanced ADORA2B signaling-mediated endothelin-1 induction in a hypoxia-inducible factor-alpha-dependent manner.PMID:23584256
A2B receptors are expressed in neuroendocrine tumors during cellular stress, damage and hypoxia.PMID:22119961
The most recent evidence concerning the role of ADORA2B and its potential therapeutic relevance is discussed. [Review Article]PMID:22963436
Identification of a pharmacologically tractable Fra-1/ADORA2B axis promoting breast cancer metastasis.PMID:23483055
Binding of A(2B)AR to specific sites on p105 prevents polyubiquitylation and degradation of p105 protein.PMID:22767505
study identified the A2bAR as a significant regulator of HFD-induced hallmarks of T2D, thereby pointing to its therapeutic potential.PMID:22848385
Distinct interactions of structurally diverse ligands with the human A(2B) receptor and differences between closely related receptor subtypes.PMID:23286920
A(2B)ARs mediate C. difficile toxin-induced enteritis and disease.PMID:23045479
ADORA2B is a candidate gene known to modify the severity of sickle cell disease.PMID:22679008
A(1) and A(2B)adenosine receptors could be potential biomarkers to provide an early indication of SA risk and their stimulation may turn out to improve fetoplacental perfusion by increasing vascular endothelial growth factor (VEGF) and nitric oxide (NO).PMID:22867902
[review] There is evidence that the ADORA2B receptor has cardioprotective effects upon its activation. However, controversy remains regarding the precise timing of activation required to induce cardioprotection.PMID:21335481
adenosine stimulates human endothelial progenitor cells migration by activating A2A and A, but not A2B, receptors and provides evidence to support a role of adenosine in modulating angiogenic capacity of hEPCPMID:22217884
studies identify adenosine-elicited stabilization of Per2 in the control of HIF-dependent cardiac metabolism and ischemia tolerance and implicate Per2 stabilizationPMID:22504483
2',3'-cAMP inhibits proliferation of vascular smooth muscle cells from the aorta and coronary arteries. This effect is due in part to metabolism of 2',3'-cAMP to adenosine, with engagement of the A2B receptor.PMID:21622827
Only the disulfide bond of the adenosine A2B receptor is essential for ligand binding and receptor activation.PMID:21620804
The main differences between the general dynamic behaviors of the A(2A)AR receptors and A(2B)AR receptors explored can be explained in terms of their particular sequences, loops lengths, and disulfide bridges.PMID:21480628
Adenosine A(B) receptors mediate an early induction of NR4A1 and a decrease in cell proliferation via the cAMP/Epac pathway in coronary artery smooth muscle cells.PMID:21109603
The ability of transgenic A2BR blockade to reduce circulating interleukin (IL)-6 levels by 24 hr may be explained by the reduction of bacterial load, and reflects that transgenic mice are going to live.PMID:21242513
The results of this study suggest that deterioration of structure in the extracellular domains of GPCRs compromises overall receptor structure with profound consequences for receptor activation and constitutive activity.PMID:21030693
ADORA2B was overexpressed in colorectal carcinomas grown under a hypoxic state, presumably promoting cancer cell growth.PMID:20619442
TNF-alpha-induced A(2B)AR expression in colonic epithelial cells is post-transcriptionally regulated by miR27b and miR128aPMID:20388705