Recombinant Human Activator of apoptosis harakiri (HRK)

Code: CSB-CF010741HU
Size:
20μg
20μg100μg
US$3175
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
HRK
Uniprot NO.
Alternative Names
HRK; BID3; Activator of apoptosis harakiri; BH3-interacting domain-containing protein 3; Neuronal death protein DP5
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-91
Target Protein Sequence
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAP APGALPTYWPWLCAAAQVAALAAWLLGRRNL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Promotes apoptosis.
Gene References into Functions
  1. The apoptosis phenotype was partly dependent on HRK upregulation, as HRK knockdown significantly abrogated the sensitization. KDM2B-silenced tumors exhibited slower growth in vivo. Taken together, our findings suggest a novel mechanism, where the key apoptosis components are under epigenetic control of KDM2B in glioblastoma multiforme cells. PMID:28661478
  2. miR-23a-3p, miR-23b-3p, and miR-149-5p, were downregulated by cytokines and selected for further studies. These miRNAs were found to regulate the expression of the proapoptotic Bcl-2 proteins DP5 and PUMA and consequent human beta-cell apoptosis. PMID:27737950
  3. our findings suggest that induction of the BH3-only protein Hrk is a critical step in 2-ME activation of the JNK-induced apoptotic pathway, targeting mitochondria by liberating proapoptotic protein Bak. PMID:23580416
  4. SUZ12 promotes the proliferation of human EOC cells by inhibiting apoptosis and HRK is a novel SUZ12 target gene whose upregulation contributes to apoptosis induced by SUZ12 knockdown. PMID:22964433
  5. Diva binds peptides derived from the BH3 domain of several other proapoptotic Bcl-2 proteins, including mouse Harakiri, Bid, Bak and Bmf. PMID:23192964
  6. The BH3-only protein harakiri (HRK) is transactivated by ATF4 in severe hypoxia through direct binding of ATF4 to the promoter region. PMID:23090478
  7. Data suggest that DP5 and PUMA/BBC3 (p53 up-regulated modulator of apoptosis/bcl-2-binding component 3) contribute to palmitate-induced apoptosis of pancreatic beta-cells via lipotoxic endoplasmic reticulum stress. PMID:22773666
  8. These results are used to propose a tentative structural model of how Harakiri works. PMID:21731739
  9. analysis of a novel interaction between Bcl-2 members Diva and Harakiri PMID:21209886
  10. Hrk is involved in the induction of apoptosis in RGCs after optic nerve transection. PMID:11796190
  11. apoptosis inducers as diverse as oncoprotein inhibitors and cell death receptor activators trigger Hrk expression via blockade of DREAM in leukemia cells PMID:12217801
  12. Data report that human oocytes and fragmenting preimplantation embryos possess transcripts encoding Harakiri and caspase-3. PMID:12606589
  13. HRK is a target of epigenetic inactivation in colorectal and gastric cancer PMID:14695142
  14. The interaction between HRK and cellular protein p32 was studied. HRK-induced apoptosis was suppresssed by the expression of p32 mutants lacking the N-terminal sequences 74-282 and the C-terminal sequences 1-221. PMID:15031724
  15. HRK appears to be inactivated principally by promoter hypermethylation in prostate cancers and decreased expression may play an important role in tumor progression by modulating apoptotic cell death PMID:18008329
  16. in response to PAHs, Ahr-mediated activation of the harakiri, BCL2 interacting protein (contains only BH3 domain), was necessary for execution of cell death. PMID:18037991
  17. Aberrant 5'-CpG methylation status and loss of heterozygosity on 12q13.1 are associated with HRK expression in human malignancies, including prostate cancers, astrocytic tumors and primary central nervous system lymphomas. Review. PMID:19641496

Show More

Hide All

Subcellular Location
Membrane; Single-pass membrane protein. Mitochondrion.
Database Links

HGNC: 5185

UNIGENE: Hs.26605

KEGG: hsa:8739

STRING: 9606.ENSP00000257572

OMIM: 603447

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products