Home
Product
Protein
Transmembrane Proteins
Recombinant Human ATP-binding cassette sub-family G member 4 (ABCG4)

Recombinant Human ATP-binding cassette sub-family G member 4 (ABCG4)

Code: CSB-CF887952HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7328

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ABCG4

Uniprot NO.

Q9H172

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-646

Target Protein Sequence

MAEKALEAVGCGLGPGAVAMAVTLEDGAEPPVLTTHLKKVENHITEAQRFSHLPKRSAVD IEFVELSYSVREGPCWRKRGYKTLLKCLSGKFCRRELIGIMGPSGAGKSTFMNILAGYRE SGMKGQILVNGRPRELRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQEVKKEL VTEILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSASCFQVV SLMKSLAQGGRTIICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGLGLHCP TYHNPADFIIEVASGEYGDLNPMLFRAVQNGLCAMAEKKSSPEKNEVPAPCPPCPPEVDP IESHTFATSTLTQFCILFKRTFLSILRDTVLTHLRFMSHVVIGVLIGLLYLHIGDDASKV FNNTGCLFFSMLFLMFAALMPTVLTFPLEMAVFMREHLNYWYSLKAYYLAKTMADVPFQV VCPVVYCSIVYWMTGQPAETSRFLLFSALATATALVAQSLGLLIGAASNSLQVATFVGPV TAIPVLLFSGFFVSFKTIPTYLQWSSYLSYVRYGFEGVILTIYGMERGDLTCLEERCPFR EPQSILRALDVEDAKLYMDFLVLGIFFLALRLLAYLVLRYRVKSER
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

ATP-dependent transporter of the ATP-binding cassette (ABC) family that may be involved in the cellular efflux of sterols, in particular cholesterol and desmosterol (a cholesterol precursor), to high-density lipoprotein (HDL). May play an important role in the removal of amyloid-beta peptides from brain, in a process that can be antagonized by desmosterol. However it is unclear whether ABCG4 can directly transport amyloid-beta peptides or whether peptide export may be facilitated due to changes in the membrane lipid environment. Induces apoptosis in various cells.

Gene References into Functions

Modulation of miR-185-5p expression by EBV-miR-BART6 contributes to developmental differences in ABCG4 gene expression in human megakaryocytes PMID:27816548
ABCG1 and ABCG4 alter the distribution of gamma-secretase on the plasma membrane, leading to the decreased gamma-secretase activity and suppressed Abeta secretion PMID:27196068
Both the full-length and the short isoforms of ABCG1 can dimerize with ABCG4, whereas the ABCG2 multidrug transporter is unable to form a heterodimer with ABCG4. PMID:27228027
Study suggests that high ABCG4 expression is associated with poor prognosis in patients with non-small-cell lung cancer with advanced stages. PMID:26270652
HUWE1 and NEDD4-1 are two E3 ligases that are fundamental enzymes in the post-translational regulation of ABCG1 and ABCG4 protein levels and cellular cholesterol export activity PMID:26296893
These results suggest that ABCA1, ABCG1, and ABCG4 are localized to distinct membrane meso-domains and disturb the meso-domain structures by reorganizing lipids on the plasma membrane PMID:25302608
This study demonstreated that Abcg4 acts in concert with Abcg2 to efflux Abeta from the brain across the blood-brain barrier. PMID:22391220
Human and mouse orthologs of a new ATP-binding cassette gene, ABCG4: maps to human chromosome 11, is expressed abundantly in brain, and has alternatively-spliced isoforms PMID:11856881
ABCG4 is expressed specifically in the brain and the eye. PMID:12183068
ABCG1 and ABCG4 act in concert with ABCA1 to maximize the removal of excess cholesterol from cells and to generate cholesterol-rich lipoprotein particles PMID:16902247
ABCG4 is highly expressed in microglia on alzheimer disease brain. PMID:18508037
Human ABC transporters ABCG2 (BCRP) and ABCG4 PMID:18668433
ABCG4 may be involved in macrophage lipid homeostasis. PMID:11606068

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle membrane; Multi-pass membrane protein. Endosome membrane; Multi-pass membrane protein.

Protein Families

ABC transporter superfamily, ABCG family, Eye pigment precursor importer (TC 3.A.1.204) subfamily

Tissue Specificity

Expressed specifically in the brain and the eye.

Database Links

HGNC: 13884

UNIGENE: Hs.126378

KEGG: hsa:64137

STRING: 9606.ENSP00000304111

OMIM: 607784

Promotions