Home
Product
Protein
Transmembrane Proteins
Recombinant Human ATP-binding cassette sub-family B member 10, mitochondrial (ABCB10)

Recombinant Human ATP-binding cassette sub-family B member 10, mitochondrial (ABCB10)

Code: CSB-CF878869HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$7231

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

ABCB10

Uniprot NO.

Q9NRK6

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

106-738

Target Protein Sequence

AGPGAPRLPRARFPGGPAAAAWAGDEAWRRGPAAPPGDKGRLRPAAAGLPEARKLLGLAY PERRRLAAAVGFLTMSSVISMSAPFFLGKIIDVIYTNPTVDYSDNLTRLCLGLSAVFLCG AAANAIRVYLMQTSGQRIVNRLRTSLFSSILRQEVAFFDKTRTGELINRLSSDTALLGRS VTENLSDGLRAGAQASVGISMMFFVSPNLATFVLSVVPPVSIIAVIYGRYLRKLTKVTQD SLAQATQLAEERIGNVRTVRAFGKEMTEIEKYASKVDHVMQLARKEAFARAGFFGATGLS GNLIVLSVLYKGGLLMGSAHMTVGELSSFLMYAFWVGISIGGLSSFYSELMKGLGAGGRL WELLEREPKLPFNEGVILNEKSFQGALEFKNVHFAYPARPEVPIFQDFSLSIPSGSVTAL VGPSGSGKSTVLSLLLRLYDPASGTISLDGHDIRQLNPVWLRSKIGTVSQEPILFSCSIA ENIAYGADDPSSVTAEEIQRVAEVANAVAFIRNFPQGFNTVVGEKGVLLSGGQKQRIAIA RALLKNPKILLLDEATSALDAENEYLVQEALDRLMDGRTVLVIAHRLSTIKNANMVAVLD QGKITEYGKHEELLSKPNGIYRKLMNKQSFISA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Catalyzes the export of an unknown physiological substrate from the mitochondrial matrix to the cytosol in an ATP-dependent manner. May also transport the heme analog Zn (II) mesoporphyrin (ZnMP) in an ATP dependent manner but can't export the heme precursor 5-aminolevulinic acid (ALA) from mitochondria. Plays a role in the early step of the heme biosynthetic process during insertion of iron into protoporphyrin IX (PPIX). In turn participates in hemoglobin synthesis and also protects against oxidative stress. In addition may be involved in mitochondrial unfolded protein response (UPRmt) signaling pathway, although ABCB10 probably does not participate in peptide export from mitochondria.

Gene References into Functions

Data suggest that ABCB10 silencing results in alteration in heme biosynthesis transcriptional profile due to repression by transcriptional regulator BACH1. (ABCB10 = ATP-binding cassette, sub-family B [MDR-TAP], member 10; BACH1 = BTB and CNC homology 1, basic leucine zipper transcription factor 1) PMID:28808058
ABCB10 is involved in unfolded protein response signaling pathway, although it probably does not participate in peptide export from mitochondria. PMID:28315685
ABCB10 is required for primitive erythropoiesis and to protect from oxidative stress associated with cardiac ischemia-reperfusion in mice. Antioxidants can rescue the defects associated with ABCB10 loss-of-function in mice. PMID:22884976
ABCB10 is not a heme exporter but is required for the early mitochondrial steps of heme biosynthesis. PMID:23720443
Data indicate that ABCB10 may exist in an open-inwards conformation when nucleotide is bound. PMID:23716676
Human mitochondrial ATP-binding cassette transporter ABCB10 is required for efficient red blood cell development. PMID:22085049
study of ABCB10 targeting, import, and dimerization PMID:15215243

Hide All

Subcellular Location

Mitochondrion inner membrane; Multi-pass membrane protein.

Protein Families

ABC transporter superfamily, ABCB family, Mitochondrial peptide exporter (TC 3.A.1.212) subfamily

Tissue Specificity

Ubiquitous. Highly expressed in bone marrow, expressed at intermediate to high levels in skeletal muscle, small intestine, thyroid, heart, brain, placenta, liver, pancreas, prostate, testis, ovary, leukocyte, stomach, spinal cord, lymph node, trachea and

Database Links

HGNC: 41

UNIGENE: Hs.17614

KEGG: hsa:23456

STRING: 9606.ENSP00000355637

OMIM: 605454

Promotions