Recombinant Human 5-hydroxytryptamine receptor 6 (HTR6)

Code: CSB-CF010898HU
Size:
20μg
20μg100μg
US$5787
Quantity:
Express system: in vitro E.coli expression system
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
HTR6
Uniprot NO.
Species
Homo sapiens (Human)
Source
in vitro E.coli expression system
Expression Region
1-440
Target Protein Sequence
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF FNIDPAEPELRPHPLGIPTN
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. It has a high affinity for tricyclic psychotropic drugs. Controls pyramidal neurons migration during corticogenesis, through the regulation of CDK5 activity. Is an activator of TOR signaling.
Gene References into Functions
  1. Serotonin 6 receptor has a role in Alzheimer's disease and depression PMID:26449188
  2. that HTR6 plays an important role in modulating seizure activity and that the blockade of the 5-HT6 receptor/mTOR pathway could be a potential therapeutic target for epilepsy treatment PMID:25034463
  3. Studies indicate that serotonin 5-HT6 receptor (5-HT6R) has been proposed as a promising drug target for cognition enhancement in Alzheimer's disease (AD). PMID:24850589
  4. [review] Controlling the activity of 5-HTR6 receptors seems to provide benefits by alleviating cognitive impairments. PMID:23844689
  5. Data indicate that hydrogen-bond formation of a methoxy or hydroxy group is not important for binding at the 5-HT6 receptor. PMID:23542166
  6. The human cloned 5-HT6 receptor is stably transfected in HeLa cells. PMID:15482912
  7. When expressed in pyramidal neuron progenitors, serotonin receptor 5-HT6 transgene decreases the migration speed of cortical pyramidal neurons, thereby affecting a fundamental step in the assembly of neural circuits. PMID:22833193
  8. These observations suggest that recruitment of mTOR by prefrontal 5-HT(6) receptors contributes to the perturbed cognition in schizophrenia, offering new vistas for its therapeutic control. PMID:23027611
  9. There was a statistically significant difference in semantic memory scores among the three genotype groups of T267C in 5-HT6. PMID:21728060
  10. present findings showed the presence of a higher density of 5-HT(6) receptors, as labeled by [(125)I]SB-258585, in striatum than in hippocampus and prefrontal cortex, and specifically within the neuronal body PMID:22278721
  11. results indicate that tagging SNPs in HTR6 may not play a role in the pathophysiology of schizophrenia. PMID:22745941
  12. [review] Since discovery of the 5-HT6 receptor and development of its small-molecule ligands, neurochemical and localization studies have clearly demonstrated its central role in modulating GABAergic neurotransmission across brain structures and networks. PMID:21329782
  13. detected association between 2 markers (rs6693503 and rs1805054) and three markers (rs6693503, rs1805054 and rs4912138) in HTR6 and METH-induced psychosis respectively. HTR6 may play important role in pathophysiology of METH-induced psychosis in Japanese PMID:20705401
  14. Common variants in the gene for HT6R do not contribute to obesity. PMID:21273698
  15. we found no association involving HTR6 polymorphism and mood disorder in the Japanese population PMID:20394784
  16. Data show that analogues of 5-cyclic amine-3-arylsulfonylindazoles have been identified as high-affinity 5-HT(6) receptor ligands. PMID:20170099
  17. Jab1 provides a novel signal transduction pathway for 5-HT(6)R and may play an important role in 5-HT(6)R-mediated behavior changes in the brain PMID:20093369
  18. SNP might have a role in the etiology of suicide in male subjects in the Portuguese population. PMID:19782122
  19. 5-HT6 receptor gene polymorphism C267T is associated with Parkinson's disease. PMID:11889255
  20. Association of the 5-hydroxytryptamine(6) receptor gene in Alzheimer's disease. apolipoprotein E epsilon 4 status. the 267C allele of the 5-HT(6) receptor gene may not be a genetic risk factor for AD. PMID:12023056
  21. significant relationship between 5-HT(6) receptor gene polymorphism (C267T) and self-transcendence PMID:14698468
  22. These data do not support the idea that the 5-HT(6) receptor gene plays a major role in the etiopathogenesis of schizophrenia. PMID:15048641
  23. The serotonin type 6 (5-HT(6)) receptor is a G-protein coupled receptor (GPCR) coupled to a stimulatory G-protein (G(S)). PMID:15737640
  24. In aging control patients, the 5-HT6 receptor was expressed by pyramidal cells and some stellate cells,in layers II-V, and layer I, where a distinct label was observed in neurons and surrounding fibers.In AD patients was significantly decreased by 40%. PMID:16640790

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in several human brain regions, most prominently in the caudate nucleus.
Database Links

HGNC: 5301

UNIGENE: Hs.22180

KEGG: hsa:3362

STRING: 9606.ENSP00000289753

OMIM: 601109

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products