MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF FNIDPAEPELRPHPLGIPTN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that stimulate adenylate cyclase. It has a high affinity for tricyclic psychotropic drugs. Controls pyramidal neurons migration during corticogenesis, through the regulation of CDK5 activity. Is an activator of TOR signaling.
Gene References into Functions
Serotonin 6 receptor has a role in Alzheimer's disease and depressionPMID:26449188
that HTR6 plays an important role in modulating seizure activity and that the blockade of the 5-HT6 receptor/mTOR pathway could be a potential therapeutic target for epilepsy treatmentPMID:25034463
Studies indicate that serotonin 5-HT6 receptor (5-HT6R) has been proposed as a promising drug target for cognition enhancement in Alzheimer's disease (AD).PMID:24850589
[review] Controlling the activity of 5-HTR6 receptors seems to provide benefits by alleviating cognitive impairments.PMID:23844689
Data indicate that hydrogen-bond formation of a methoxy or hydroxy group is not important for binding at the 5-HT6 receptor.PMID:23542166
The human cloned 5-HT6 receptor is stably transfected in HeLa cells.PMID:15482912
When expressed in pyramidal neuron progenitors, serotonin receptor 5-HT6 transgene decreases the migration speed of cortical pyramidal neurons, thereby affecting a fundamental step in the assembly of neural circuits.PMID:22833193
These observations suggest that recruitment of mTOR by prefrontal 5-HT(6) receptors contributes to the perturbed cognition in schizophrenia, offering new vistas for its therapeutic control.PMID:23027611
There was a statistically significant difference in semantic memory scores among the three genotype groups of T267C in 5-HT6.PMID:21728060
present findings showed the presence of a higher density of 5-HT(6) receptors, as labeled by [(125)I]SB-258585, in striatum than in hippocampus and prefrontal cortex, and specifically within the neuronal bodyPMID:22278721
results indicate that tagging SNPs in HTR6 may not play a role in the pathophysiology of schizophrenia.PMID:22745941
[review] Since discovery of the 5-HT6 receptor and development of its small-molecule ligands, neurochemical and localization studies have clearly demonstrated its central role in modulating GABAergic neurotransmission across brain structures and networks.PMID:21329782
detected association between 2 markers (rs6693503 and rs1805054) and three markers (rs6693503, rs1805054 and rs4912138) in HTR6 and METH-induced psychosis respectively. HTR6 may play important role in pathophysiology of METH-induced psychosis in JapanesePMID:20705401
Common variants in the gene for HT6R do not contribute to obesity.PMID:21273698
we found no association involving HTR6 polymorphism and mood disorder in the Japanese populationPMID:20394784
Data show that analogues of 5-cyclic amine-3-arylsulfonylindazoles have been identified as high-affinity 5-HT(6) receptor ligands.PMID:20170099
Jab1 provides a novel signal transduction pathway for 5-HT(6)R and may play an important role in 5-HT(6)R-mediated behavior changes in the brainPMID:20093369
SNP might have a role in the etiology of suicide in male subjects in the Portuguese population.PMID:19782122
5-HT6 receptor gene polymorphism C267T is associated with Parkinson's disease.PMID:11889255
Association of the 5-hydroxytryptamine(6) receptor gene in Alzheimer's disease. apolipoprotein E epsilon 4 status. the 267C allele of the 5-HT(6) receptor gene may not be a genetic risk factor for AD.PMID:12023056
significant relationship between 5-HT(6) receptor gene polymorphism (C267T) and self-transcendencePMID:14698468
These data do not support the idea that the 5-HT(6) receptor gene plays a major role in the etiopathogenesis of schizophrenia.PMID:15048641
The serotonin type 6 (5-HT(6)) receptor is a G-protein coupled receptor (GPCR) coupled to a stimulatory G-protein (G(S)).PMID:15737640
In aging control patients, the 5-HT6 receptor was expressed by pyramidal cells and some stellate cells,in layers II-V, and layer I, where a distinct label was observed in neurons and surrounding fibers.In AD patients was significantly decreased by 40%.PMID:16640790
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in several human brain regions, most prominently in the caudate nucleus.