Home
Product
Protein
Transmembrane Proteins
Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A)

Recombinant Human 5-hydroxytryptamine receptor 5A (HTR5A)

Code: CSB-CF010896HU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5166

Quantity:

Express system: in vitro E.coli expression system

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

HTR5A

Uniprot NO.

P47898

Species

Homo sapiens (Human)

Source

in vitro E.coli expression system

Expression Region

1-357

Target Protein Sequence

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins.

Gene References into Functions

Results suggest that TPH1 218A/C and HTR5A 12A/T polymorphisms cannot predict treatment response in major depression PMID:24903772
Childhood anxiousness did not mediate the effects of HTR2A and HTR5A on mood disorders. PMID:19381154
Serotonin (5-HT) receptor 5A sequence variants affect human plasma triglyceride levels PMID:20388841
Association of a SNP of HTR5A gene is a susceptibility factor to bipolar disease in Bulgarian population. PMID:19328558
N-glycosylation of the N6 residue is important for the membrane expression of this 5-HT5A neurotransmitter receptor; a requirement for receptor function. PMID:17881091
In individuals in Brazil with the A/A variant of the -1438G/A polymorphism of the 2A receptor gene, the effect of cultural consonance in family life on depressive symptoms over a 2 year period was larger than those with the G/A or G/G variants. PMID:18802937
The receptor has been transiently expressed in Cos M6 cells and exhibits a pharmacological profile closely resembling the mouse and rat 5-HT5A receptors with high, specific binding for ergotamine and methiothepin. PMID:7988681