MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC RQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances. Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors, such as adenylate cyclase. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling inhibits adenylate cyclase activity and activates a phosphatidylinositol-calcium second messenger system that regulates the release of Ca(2+) ions from intracellular stores. Plays a role in the regulation of 5-hydroxytryptamine release and in the regulation of dopamine and 5-hydroxytryptamine metabolism. Plays a role in the regulation of dopamine and 5-hydroxytryptamine levels in the brain, and thereby affects neural activity, mood and behavior. Plays a role in the response to anxiogenic stimuli.
Gene References into Functions
Study related 5-HT1A -cortical thickness correlation coefficients to the number of tracts connecting that region and the raphe, as measured by diffusion tensor imaging. The 5-HT1A -cortical thickness association correlated significantly with the number of tracts to each region. Defect in the raphe may affect the PCC within the default mode network in major depressive disorder through serotonergic fibers.PMID:29323797
The results suggest that HTR1A/1B DNA hypomethylation and its interaction with recent life stress might drive impaired antidepressant treatment response. Meanwhile, DNA methylation, in turn, was modified by antidepressant treatment and environments.PMID:29275155
Study found a significant interaction effect of the serotonin transporter-linked polymorphic region (5-HTTLPR) and the polymorphism in the serotonin 1A receptor gene (rs6295) on the connectivity within the right frontoparietal network, specifically in the middle frontal gyrus and inferior parietal lobule. Mean connectivity in the right inferior parietal lobule was positively correlated with working memory performance.PMID:28793232
results provide further supportive evidence of the effect of HTR1A and HTR5A on the etiology of schizophrenia and suggest that the selected genetic variations in HTR5A may be involved in impaired executive function.PMID:27897266
It is unlikely that the investigated genetic variants are clinically relevantly associated with depression after diagnosis of cancer.PMID:28590587
Studied association of aggression and 5-HTTLPR, 5HTR1A, and 5HTR2A genetic polymorphisms in industrial Russian and traditional Tanzanian population groups.PMID:29661255
Our results are in line with preclinical data, mouse model knockout studies as well as previous clinical analyses in major depressive disorder, demonstrating the two-pronged effect of the G allele on 5-HT1A receptor binding for, we believe, the first time.PMID:28608854
In summary, our results suggest that, by genetic association, the mu-opioid receptor interacts with serotonin transporter and serotonin 1A receptor to modulate exercise-induced hypoalgesia in fibromyalgia.PMID:28282362
Both expressions of CC2D1A and HTR1A genes studied on autism spectrum disorder cases and controls were significantly differentPMID:26782176
Review/Meta-analysis: antipsychotic treatment may be more effective in improving negative symptoms in schizophrenic C allele than in G allele carriers of the HTR1A rs6295 polymorphism.PMID:26568455
The rs6295 single nucleotide polymorphism (SNP) in the 5HTR1A promoter region was associated with suicide attempt, psychiatric hospitalizations, and substance use disorderPMID:28470485
the rs6295 SNP, as a suspected variant that indicates susceptibility to schizophrenia, exhibited a higher transcriptional activity.PMID:27939355
This study demonstrated that a significant decrease in the protein level of 5-HT1A in major depression disorder.PMID:27661418
5-HT1A rs10042486 was significantly associated with schizophreniaPMID:27756686
Results reveal the broad dependence that the 5-HT1A receptor has on plasma membrane properties, demonstrating that membrane lipid composition is a biochemical control parameter and highlighting the possibility that compositional changes related to aging, diet, or disease could impact cell signaling functionsPMID:27276266
Sphingosine modulates the function of human serotonin1A receptors.PMID:27984018
The ganglioside GM1 interacts with the serotonin1A receptor via the sphingolipid binding domain.PMID:27552916
5-HT1A C-1019G (rs6295) can predict aripiprazole treatment response specifically for cognitive and depressive symptoms in schizophrenia.PMID:28027114
results show that the oxidation of the hydroxyl group of cholesterol in live cells resulted in enhancement of agonist binding and G-protein coupling to the serotonin1A receptor with no appreciable change in overall membrane order; results extend our understanding of the structural requirements of cholesterol for receptor functionPMID:28109756
rs6295 [C]-allele protects against depressive mood in elderly endurance athletesPMID:26866771
A single-nucleotide polymorphism of the serotonin 1a receptor gene (HTR1A) has been designated rs6295.28 and found to be overrepresented in suicide and associated with a decreased responsiveness to antidepressants.PMID:26926882
Results reported here strongly support the role of 5-HT1A partial agonism as a means of restoring cognitive function following subchronic treatment with an NMDAR non-competitiave antagonistPMID:26342283
This study demonistrated that cue learning, trait anxiety and genetic variability in 5-HTR1A are involved in the regulation of contextual anxiety.PMID:25448266
epistatic effects of 5HTR1A and 5HTR2A genes on suicidal behaviour were not significantPMID:26544898
Our findings provide supportive evidence that genetic polymorphisms in SLC6A4 and HTR1A may influence the risk of SZ in Han Chinese individualsPMID:26408209
IPO11-HTR1A is a significant risk gene region for attention deficit hyperactivity disorder in Caucasians.PMID:26079129
Also patients with a higher level of alexithymia and the HTR1A-G gene variant are more vulnerable to experiencing IFN-induced depressive symptomsPMID:26609890
No significant association was found between SNPs in HTR1A (rs6295), HTR2A (rs6311 and rs6313) and SLC6A4 and response to escitalopram in patients with major depressive disorderPMID:26261165
SNPs associated antipsychotic effectiveness in schizophreniaPMID:25822479
Increased serotonin function may result in further dysregulation of thalamocortical signals and so promote the expression of dyskinesias.PMID:25649022
The data on the distribution of allele and genotype frequencies of the HTR1A, HTR2A, and HTR1B genes can be used to determine the associations of the identified markers with various forms of human aggressive behavior.PMID:26845861
Studied site-directed mutants of the HTR1A receptor in application of yeast-based signaling sensor.PMID:25850571
mood disorders and HTR1A G allele variation, the C-1019G polymorphism of the transcriptional control region of the 5-HT1A receptor, independently predicted the incidence of IFN-induced depression in HCV patients.PMID:26001668
There was no impact of BDNF Val66Met genotype on serotonin transporter and serotonin-1A receptor BDNF binding.PMID:25188405
The C-1019G polymorphism of 5-HT1A was significantly associated with the odds of being single both before and after controlling for socioeconomic status, external appearance, religious beliefs, parenting style, and depressive symptoms.PMID:25412229
The findings support the hypothesis that COMT rs4680 and 5-HT1A-R rs6295 polymorphisms could influence the negative symptom response to clozapine, probably through modulation of the dopaminergic system.PMID:25560469
polymorphisms in the serotonin transporter gene are not associated with thermal pain sensation in healthy individualsPMID:25472558
The present results demonstrate that 5-HT signaling through the 5-HT1A receptor regulates some circadian propertiesPMID:25446224
Results suggest that the epileptic hippocampus of patients with mesial temporal lobe epilepsy presents an increase in 5-HT1A receptor-induced G-protein functional activationPMID:25304920
These findings provide the first evidence for the link between 5-HT1A and the development of alexithymic characteristics and attachment orientation.PMID:25247748
HTR1A variants play a central role in differentiating subgroups of patients with anxiety disorders.PMID:25514753
G/G genotype of HTR1A (rs6295) is associated with poor working memory in the premenstrual phase of PMDD-diagnosed women.PMID:24158751
Compared to GG and CG (1019) genotypes, men with CC genotype had a 250% and 190% shorter ejaculation time, respectively.PMID:24440118
5-HT1A autoreceptors are recruited into a FGFR1-5-HT1A heteroreceptor complex in the midbrain raphe 5-HT nerve cells and may develop a novel function: a trophic role in midbrain 5-HT neuron systems originating from the dorsal and medianus raphe nucleiPMID:25485703
Epigenetic modification of transcriptional regulation by specific cytosine methylation may modulate HTR1A expression, resulting in effects on emotional dysfunction and negative symptom response to antipsychotic treatment.PMID:24331356
These data support a role for the 5-HT1A receptor in the aberrant decision-making that can occur in neuropsychiatric disorders such as depressionPMID:24429872
In this review, 5-HT1A receptors are shown to interact with 5-HT7 receptors and have a role in depressive disorders.PMID:24935787
This study demonistrated that overexpression of platelet 5-HT1A receptors and reduced 5-HT tone may function as a peripheral marker of depression.PMID:24657886
IFN-alpha-related depression is associated with the CC genotype of the 5-HTR1A gene in hepatitis C patients.PMID:24462335
study found that rs6295 had no significant effect on the course of illness or treatment response in bipolar I disorderPMID:24460115