Home
Product
Protein
Transmembrane Proteins
Recombinant Horse Interleukin-7 receptor subunit alpha (IL7R)

Recombinant Horse Interleukin-7 receptor subunit alpha (IL7R)

Code: CSB-CF011670HO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5772

Quantity:

Express system: in vitro E.coli expression system

Species: Equus caballus (Horse)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

IL7R

Uniprot NO.

A0MSX9

Species

Equus caballus (Horse)

Source

in vitro E.coli expression system

Expression Region

21-458

Target Protein Sequence

ESGYAQNGDFEDAELDDYSFSCYSQLEVDGPQHLLSCAFEDPDVNSTNLEFEICEGLLEVKCLNFSKLQETYFIKTKKFLLIGDSTICVKLGGKHITCQKLNIVKRVKPEAPFDVKVIYREEANEFVVTFNTSHLQKKYVKDLLHEVVYRLEKNENDWMHVNISSTKLTLLQRKLQPNAMYEIKVRSIPNTNYFEGFWSEWSPSSHFRTPENNSGKMDPVLLIISIVSFFSVALMVILACVLWKKRIKPIVWPSLPDHKKTLEQLCKKPKKNLNVSFNPESFLDCQIHKVDGIQARDEAEAFLQDTFPPQLDDSEKQRLGGGVQGLNWPSQHAVITPKTFGGESPLRCLSGSVTVCDVPVIPSSRPPDCREGGKNGPHVYQGLLLGAGTTNSTLPHLFPFQSGILTLNPAVQGQPLFTSLGSSQEEAYVTMSSFYQNQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for interleukin-7. Also acts as a receptor for thymic stromal lymphopoietin (TSLP).

Gene References into Functions

Data show a statistically significant association between a single nucleotide polymorphism (SNP) within the interleukin 7 receptor-encoding gene (IL7R) with high R. equi burden. PMID:20002811

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Type I cytokine receptor family, Type 4 subfamily

Database Links

UNIGENE: Eca.472

KEGG: ecb:100034169

STRING: 9796.ENSECAP00000008818

Promotions