Home
Product
Protein
Transmembrane Proteins
Recombinant Drosophila melanogaster Serine protease HTRA2, mitochondrial (HtrA2)

Recombinant Drosophila melanogaster Serine protease HTRA2, mitochondrial (HtrA2)

Code: CSB-CF892839DLU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4956

Quantity:

Express system: in vitro E.coli expression system

Species: Drosophila melanogaster (Fruit fly)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

HtrA2

Uniprot NO.

Q9VFJ3

Species

Drosophila melanogaster (Fruit fly)

Source

in vitro E.coli expression system

Expression Region

94-422

Target Protein Sequence

SKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQPITASNGSGFIIEQNGLIL TNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLRIQVNNLSVMRLGKSSTLRS GEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINYLQTDAAITFGNSGGPLVNL DGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSAYKTGYPVKRYMGITMLTLT PDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPGDIVTHINKKEIKNSSDVYD ALADNSKTLDIVILRGVKQMHVTITPEDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.

Gene References into Functions

Mitochondrial serine protease HtrA2/Omi is an important mediator of germ cell death. PMID:23523076
Drosophila Omi (dOmi), a fly homologue of the serine protease Omi/HtrA2, alleviates th/DIAP1 inhibition of all caspases by proteolytically degrading th/DIAP1 and induces apoptosis both in cultured cells and in the developing fly eye. PMID:17557079
HtrA2 was shown to be phosphorylated in a PINK1-dependent manner, suggesting it might act in the PINK1 pathway. PMID:19282869

Hide All

Subcellular Location

Mitochondrion intermembrane space; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Protein Families

Peptidase S1C family

Database Links

UNIGENE: Dm.5609

KEGG: dme:Dmel_CG8464

STRING: 7227.FBpp0303078

Promotions