Home
Product
Protein
Transmembrane Proteins
Recombinant Drosophila melanogaster Protein rhomboid (rho)

Recombinant Drosophila melanogaster Protein rhomboid (rho)

Code: CSB-CF323222DLU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5151

Quantity:

Express system: in vitro E.coli expression system

Species: Drosophila melanogaster (Fruit fly)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

rho

Uniprot NO.

P20350

Alternative Names

rho; Ve; CG1004; Protein rhomboid; Protein veinlet

Species

Drosophila melanogaster (Fruit fly)

Source

in vitro E.coli expression system

Expression Region

1-355

Target Protein Sequence

MENLTQNVNETKVDLGQEKEKEASQEEEHATAAKETIIDIPAACSSSSNSSSYDTDCSTA SSTCCTRQGEHIYMQREAIPATPLPESEDIGLLKYVHRQHWPWFILVISIIEIAIFAYDR YTMPAQNFGLPVPIPSDSVLVYRPDRRLQVWRFFSYMFLHANWFHLGFNIVIQLFFGIPL EVMHGTARIGVIYMAGVFAGSLGTSVVDSEVFLVGASGGVYALLAAHLANITLNYAHMKS ASTQLGSVVIFVSCDLGYALYTQYFDGSAFAKGPQVSYIAHLTGALAGLTIGFLVLKNFG HREYEQLIWWLALGVYCAFTVFAIVFNLINTVTAQLMEEQGEVITQHLLHDLGVS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Acts early in embryonic development to establish position along the dorsoventral axis and then again later to specify the fate of neuronal precursor cells. Involved in EGF receptor signaling; cleaves Spitz to release the active growth factor.

Gene References into Functions

a rhomboid enhancer element that selectively labels four Drosophila embryonic neural precursors, was characterized. PMID:26252385
Structure and mechanism of rhomboid protease. PMID:23585569
analysis of EGFR-dependent network interactions that pattern Drosophila eggshell appendages; each appendage is derived from a primordium comprising a patch of cells expressing broad (br) and an adjacent stripe of cells expressing rhomboid (rho) PMID:22782725
Drosophila RHO is the founder member of a previously undescribed family of serine proteases, and could be directly responsible for the unusual, intramembranous cleavage of EGFr ligands. PMID:12221285
A key component of mitochondrial fusion, Mgm1p, is activated by a novel mitochondrial endopeptidase related to this Drosophila melanogaster signaling protein. PMID:12776123
Substrate specificity of RHO intramembrane protease is governed by helix-breaking residues in the transmembrane domain. PMID:12820957
Evolution of the trans-regulatory environment that controls rho expression in somatic follicle cells could be a major contributor to the evolutionary changes in DA number. PMID:17360774
rhomboid may function in R8 cells to activate Epidermal growth factor receptor signaling in R7 cells PMID:19261861