Recombinant Drosophila melanogaster Innexin inx6 (inx6)

Code: CSB-CF895180DLU
Size:
20μg
20μg100μg
US$6094
Quantity:
Express system: in vitro E.coli expression system
Species: Drosophila melanogaster (Fruit fly)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
Inx6
Uniprot NO.
Alternative Names
Inx6; prp6; CG17063; Innexin inx6; Innexin-6; Gap junction protein prp6; Pas-related protein 6
Species
Drosophila melanogaster (Fruit fly)
Source
in vitro E.coli expression system
Expression Region
1-481
Target Protein Sequence
MYAAVKPLSNYLRLKTVRIYDPIFTLHSKCTIVILLTCTFLLSAKQYFGEPILCLSSERQ ADYVQSYCWTMGTYILPAEVDRDGGSSWEYALYAPTSTAAETFNVSSLRALVAQNEQYAR FISIAEGVGPETRGVTKRMYLRYYQWVFMILLFQSLLFYFPSFLWKVWEGQRMEQLCCEV GDALIVEATYRTRLQMLTRYFRAQFAPIHWCYSIKYAFCELLNVFISILNFWLMDVVFNG FWYKYIHALAAIPVYDWNLWNLMTSRVFPKVAKCEMFVYGPSGTPNIMDILCVLPLNILN EKIFAVLYVWFLFIALLAIMNILYRLLVICCPELRLQLLRTHLNGMPKSHVREVLASAGY GDWFVLMCVSINVNPTLFRELLEQLYAKLNQARCTEPVFAEQPCQQVPQLAQVPQLFSHA KLDRCPSRNCSLLIDPTADRHSICTESSHRVTAMPTAPTLNLMAPNDEIISMDRFFHESH A
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Structural components of the gap junctions.
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Pannexin family
Tissue Specificity
Uniform expression in the imaginal wing disk. Expressed in an outer layer of the pupal developing CNS. Also expressed in pupal retina: cone cells and primary pigment cells.
Database Links

UNIGENE: Dm.13204

KEGG: dme:Dmel_CG17063

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products