Home
Product
Protein
Transmembrane Proteins
Recombinant Drosophila melanogaster Dopamine receptor 1 (DopR)

Recombinant Drosophila melanogaster Dopamine receptor 1 (DopR)

Code: CSB-CF334865DLU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6176

Quantity:

Express system: in vitro E.coli expression system

Species: Drosophila melanogaster (Fruit fly)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

Dop1R1

Uniprot NO.

P41596

Alternative Names

Dop1R1; DopR; DopR1; DopR35EF; CG9652; Dopamine receptor 1; D-DOP1; DmDop1; dDA1; Dopamine 1-like receptor 1

Species

Drosophila melanogaster (Fruit fly)

Source

in vitro E.coli expression system

Expression Region

20-511

Target Protein Sequence

MRAIAAIAAGVGSVAATVATSTTSSISSSTTIINTSSATTIGGNHTSGSTGFSTNSTLLD ADHLPLQLTTAKVDLDIEIDIQLLTNGYDGTTLTSFYNESSWTNASEMDTIVGEEPEPLS LVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLASLAIADLFVASLVMTF AGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDPLRYGRWVTRRV AVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVVSSCISF YFPCVVMIGIYCRLYCYAQKHVKSIKAVTRPGEVAEKQRYKSIRRPKNQPKKFKVRNLHT HSSPYHVSDHKAAVTVGVIMGVFLICWVPFFCVNITAAFCKTCIGGQTFKILTWLGYSNS AFNPIIYSIFNKEFRDAFKRILTMRNPWCCAQDVGNIHPRNSDRFITDYAAKNVVVMNSG RSSAELEQVSAI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for dopamine. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. Might be involved in the processing of visual information and/or visual learning. Important for Pavlovian conditioning: required in the mushroom body as a receptor conveying unconditional stimuli information, has a role in memory formation for aversive and appetitive learning. Sleep-deprivation-induced impairments in learning can be partially explained through alterations in dopamine signaling, Dop1R1 expression levels are reduced; sleep may have a role in restoring dopamine homeostasis.

Gene References into Functions

It is concluded that the activating effect of dopamine on JH(juvenile hormone) synthesis in Drosophila is mediated by D1-like receptors PMID:23035552
a dopamine D1-like receptor, DopR, was involved in fly courtship behavior. DopR mutant male flies display male-male courtship behavior. PMID:22683328
Juvenile hormone synthesis is stimulated by activation of dopamine D1-like receptors in Drosophila. PMID:22218953
D1 dopamine receptor dDA1 is required in the mushroom body neurons for aversive and appetitive learning in Drosophila. PMID:17634358
All our data demonstrated that activation of D1-like receptors in Drosophila neurons negatively modulates excitatory cholinergic synaptic transmission and thus inhibits neuronal excitability. PMID:17986026
This review provides evidence that dopamine D1 receptor DopR is involved in several types of attentional processes and independently regulates distinct types of arousal. PMID:19945386
Loss-of-function mutations in the D1 dopamine receptor DopR enhance repetitive startle-induced arousal while decreasing sleep-wake arousal. PMID:19945394

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Expressed in the larval and adult CNS in structures that mediate higher-order brain functions such as learning, memory and motor control: in the mushroom body neuropil and four unpaired neurons in each thoracic segment. The adult CNS has intense expressio

Database Links

UNIGENE: Dm.3077

KEGG: dme:Dmel_CG9652

STRING: 7227.FBpp0303554

Promotions