Home
Product
Protein
Transmembrane Proteins
Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2)

Recombinant Drosophila erecta Serine protease HTRA2, mitochondrial (HtrA2)

Code: CSB-CF461207DLK

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5098

Quantity:

Express system: in vitro E.coli expression system

Species: Drosophila erecta (Fruit fly)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

HtrA2

Uniprot NO.

B3P3J9

Alternative Names

HtrA2; GG21285; Serine protease HTRA2, mitochondrial; High temperature requirement protein A2

Species

Drosophila erecta (Fruit fly)

Source

in vitro E.coli expression system

Expression Region

75-422

Target Protein Sequence

AVVSAAVIKREDFTPTIAASKMTGRRRDFNFIADVVAGCADSVVYIEIKDTRHFDYFSGQ PITASNGSGFIIEQNGLILTNAHVVINKPHTMVQVRLSDGRTFPATIEDVDQTSDLATLR IQVNNLSVMRLGKSSTLRSGEWVVALGSPLALSNTVTAGVISSTQRASQELGLRNRDINY LQTDAAITFGNSGGPLVNLDGEAIGVNSMKVTAGISFAIPIDYVKVFLERAAEKRKKGSA YKTGYPVKRYMGITMLTLTPDILFELKSRSQNMPSNLTHGVLVWKVIVGSPAHSGGLQPG DIVTHINKKEIKNSSDVYDALADNSKNLDIVILRGVKQMHVTITPEDP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Serine protease that shows proteolytic activity against a non-specific substrate beta-casein. Promotes or induces cell death either by direct binding to and inhibition of BIRC proteins (also called inhibitor of apoptosis proteins, IAPs), leading to an increase in caspase activity, or by a BIRC inhibition-independent, caspase-independent and serine protease activity-dependent mechanism. Can antagonize antiapoptotic activity of th by directly inducing the degradation of th.

Subcellular Location

Mitochondrion intermembrane space; Single-pass membrane protein. Mitochondrion membrane; Single-pass membrane protein.

Protein Families

Peptidase S1C family

Database Links

KEGG: der:Dere_GG21285

Promotions