Home
Product
Protein
Transmembrane Proteins
Recombinant Dog Solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4)

Recombinant Dog Solute carrier family 2, facilitated glucose transporter member 4 (SLC2A4)

Code: CSB-CF895472DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$3707

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

SLC2A4

Uniprot NO.

Q9XST2

Alternative Names

SLC2A4; GLUT4; B146; Solute carrier family 2, facilitated glucose transporter member 4; Glucose transporter type 4, insulin-responsive; GLUT-4; Fragment

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

1-162

Target Protein Sequence

TSIFETAGVGQPAYATIGAGVVNTVFTLVSVFLVERAGRRTLHLLGLAGMCGCAILMTIA LLLLERLPAMSYVSIVAIFGFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGFCNWTS NFIIGMGFQYIAXAMGPYVFLLFAVLLLAFFIFTFLKVPETR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Insulin-regulated facilitative glucose transporter, which plays a key role in removal of glucose from circulation. Response to insulin is regulated by its intracellular localization: in the absence of insulin, it is efficiently retained intracellularly within storage compartments in muscle and fat cells. Upon insulin stimulation, translocates from these compartments to the cell surface where it transports glucose from the extracellular milieu into the cell.

Gene References into Functions

Results indicate that the state of conditioning had a significant effect on the glucose transporter-4 protein (GLUT4) expression at the surface of mononuclear cells. PMID:25236492
Damage of cardiac function during cardiopulomnary bypass are mostly associated with lower expression of Glut-4 mRNA. PMID:23111893
Chronic heart failure selectively induces regional heterogeneity of insulin-responsive glucose transporters, GLUT4/12. PMID:21849635
Suppressed translocation of GLUT-4 was also evident in dogs receiving 30-min ischemia PMID:18535164