Recombinant Dog Occludin (OCLN)

Code: CSB-CF016263DO
Size:
20μg
20μg100μg
US$6393
Quantity:
Express system: in vitro E.coli expression system
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
OCLN
Uniprot NO.
Alternative Names
OCLN; Occludin
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
in vitro E.coli expression system
Expression Region
1-521
Target Protein Sequence
MSSRPFESPPPYRPDEFKPNHYAPSNDVYGGDMHVRPMLSQPAYSFYPEDEILHFYKWTS PPGVIRILSMLVIVMCIAIFGCVASTLAWDRGYGTGLMGGSIGYPYGSGFGSYGTGYGYG FGYGYGYGGYTDPRAAKGFLLAMVAFCFIAALVIFVTSVIRSDISRTRRYYLTVIILSAF LGVMMFIATIVYIMGVNPTAQASGSLYSSQIYAMCNQFYASTATGLYMDQYLYHYCVVDP QEAIAIVLGFMVIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNV SAGTQDMPPPPSDYVERVDSPMAYSSNGKVNDKRLYPESSYKSTPVPEVVQELPATSPAD DFRQPRYSSSGHLEPPSKRAPSKGRTGRPKRLEQDHYETDYTTGGESCDELEEDWIREYP PITSDQQRQLYKRNFDTGLQEYKSLQAELDEINKELSRLDKELDDYREESEEYMAAADEY NRLKQVKGSPDYKNKRNYCKQLKSKLSHIKKMVGDYDRQKT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. Interacts with ZO-1.
Gene References into Functions
  1. In the present study, organspecific expression of the tight junction proteins, claudin, occludin, junction adhesion molecule A and zona occludens 1 was examined in the canine duodenum, lung, liver and kidney. PMID:27600198
  2. Occludin and ZO-1 expression remained unchanged between atopic and clinically normal dogs. PMID:25673908
  3. EhCP112 and EhADH112 co-localize with occludin and claudin-1 at tight junctions. PMID:23762290
  4. occludin has a role in centrosome separation and mitosis PMID:21757728
  5. The 41- and 48-kDa C-terminal occludin fragments formed during cholesterol depletion result from the action of a GM6001-sensitive metalloproteinase(s) at some point in the path leading to release of the membrane particles. PMID:19854171
  6. Removing Cholesterol from the plasma membrane increased tyrosine and threonine phosphorylation of occludin, and transepithelial electrical resistance (TER). PMID:17574235
  7. Knockdown of occludin caused mislocalization of tricellulin to bTJs, implying that occludin supports tricellular localization of tricellulin by excluding tricellulin from bicellular tight junctions. PMID:18768749
  8. a unique motif in the occludin sequence that is involved in the regulation of ZO-1 binding by reversible phosphorylation of specific Tyr residues. PMID:19017651
  9. Elevated expression of p110 CUX1 causes loss of E-cadherin and Occludin from cell-cell junctions PMID:19635798

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, tight junction.
Protein Families
ELL/occludin family
Tissue Specificity
Localized at tight junctions of both epithelial and endothelial cells.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products