Recombinant Dog Occludin (OCLN)

Code: CSB-CF016263DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6393

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

OCLN

Uniprot NO.

Q28269

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

1-521

Target Protein Sequence

MSSRPFESPPPYRPDEFKPNHYAPSNDVYGGDMHVRPMLSQPAYSFYPEDEILHFYKWTS PPGVIRILSMLVIVMCIAIFGCVASTLAWDRGYGTGLMGGSIGYPYGSGFGSYGTGYGYG FGYGYGYGGYTDPRAAKGFLLAMVAFCFIAALVIFVTSVIRSDISRTRRYYLTVIILSAF LGVMMFIATIVYIMGVNPTAQASGSLYSSQIYAMCNQFYASTATGLYMDQYLYHYCVVDP QEAIAIVLGFMVIVAFALIIFFAVKTRRKMDRYDKSNILWDKEHIYDEQPPNVEEWVKNV SAGTQDMPPPPSDYVERVDSPMAYSSNGKVNDKRLYPESSYKSTPVPEVVQELPATSPAD DFRQPRYSSSGHLEPPSKRAPSKGRTGRPKRLEQDHYETDYTTGGESCDELEEDWIREYP PITSDQQRQLYKRNFDTGLQEYKSLQAELDEINKELSRLDKELDDYREESEEYMAAADEY NRLKQVKGSPDYKNKRNYCKQLKSKLSHIKKMVGDYDRQKT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

May play a role in the formation and regulation of the tight junction (TJ) paracellular permeability barrier. Interacts with ZO-1.

Gene References into Functions

In the present study, organspecific expression of the tight junction proteins, claudin, occludin, junction adhesion molecule A and zona occludens 1 was examined in the canine duodenum, lung, liver and kidney. PMID:27600198
Occludin and ZO-1 expression remained unchanged between atopic and clinically normal dogs. PMID:25673908
EhCP112 and EhADH112 co-localize with occludin and claudin-1 at tight junctions. PMID:23762290
occludin has a role in centrosome separation and mitosis PMID:21757728
The 41- and 48-kDa C-terminal occludin fragments formed during cholesterol depletion result from the action of a GM6001-sensitive metalloproteinase(s) at some point in the path leading to release of the membrane particles. PMID:19854171
Removing Cholesterol from the plasma membrane increased tyrosine and threonine phosphorylation of occludin, and transepithelial electrical resistance (TER). PMID:17574235
Knockdown of occludin caused mislocalization of tricellulin to bTJs, implying that occludin supports tricellular localization of tricellulin by excluding tricellulin from bicellular tight junctions. PMID:18768749
a unique motif in the occludin sequence that is involved in the regulation of ZO-1 binding by reversible phosphorylation of specific Tyr residues. PMID:19017651
Elevated expression of p110 CUX1 causes loss of E-cadherin and Occludin from cell-cell junctions PMID:19635798