Recombinant Dog Histamine H2 receptor (HRH2)

Code: CSB-CF010738DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5181

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

HRH2

Uniprot NO.

P17124

Alternative Names

HRH2; Histamine H2 receptor; H2R; HH2R; Gastric receptor I

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

1-359

Target Protein Sequence

MISNGTGSSFCLDSPPCRITVSVVLTVLILITIAGNVVVCLAVGLNRRLRSLTNCFIVSL AITDLLLGLLVLPFSAFYQLSCRWSFGKVFCNIYTSLDVMLCTASILNLFMISLDRYCAV TDPLRYPVLITPVRVAVSLVLIWVISITLSFLSIHLGWNSRNETSSFNHTIPKCKVQVNL VYGLVDGLVTFYLPLLVMCITYYRIFKIARDQAKRIHHMGSWKAATIGEHKATVTLAAVM GAFIICWFPYFTVFVYRGLKGDDAINEAFEAVVLWLGYANSALNPILYATLNRDFRTAYQ QLFRCRPASHNAQETSLRSNSSQLARNQSREPMRQEEKPLKLQVWSGTEVTAPRGATDR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

The H2 subclass of histamine receptors mediates gastric acid secretion. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Gene References into Functions

Histamine H receptor blockade preserves cardiac systolic function in dogs with pacing-induced heart failure, even in the presence of beta-adrenergic receptor blockade. PMID:20852875
histamine H(2) receptors have roles in anaerobic myocardial metabolism and in ischemia and reperfusion injury PMID:16603184

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Gastric fundus and, to a lesser extent, in brain.

Database Links

UNIGENE: Cfa.3674

KEGG: cfa:403812

STRING: 9615.ENSCAFP00000037128

Promotions