Home
Product
Protein
Transmembrane Proteins
Recombinant Dog Gonadotropin-releasing hormone receptor (GNRHR)

Recombinant Dog Gonadotropin-releasing hormone receptor (GNRHR)

Code: CSB-CF009637DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4941

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

GNRHR

Uniprot NO.

Q9MZI6

Alternative Names

GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

1-327

Target Protein Sequence

MASASPEQNQNHCSAVNNSNMLMQGNLPTLTLSGKIRVTVTFFLFLLSTIFNASFLLKLQ KWTQKKEKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLK LFSMYAPAFMMVVISLDRSLAITRPLAMKNNGKLGQSMIGLAWLLSGIFAGPQLYIFRMI HLADSSGQTEGFPQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLFITLICNAKIIFTLTRV LHQDPHELQLNQSKNNIPRARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRVS DPVNHFFFLFALLNPCFDPLIYGYFSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

In the uterus, GnRH-R stained strongly in the surface and glandular epithelial cells, and seemed to be weaker in myometrium and stroma. These findings suggest a local regulatory function of gonadotropin releasing hormone during early canine pregnancy. PMID:26296524
resequencing of canine gonadotropin-releasing hormone receptor differed from that previously published by a single base change that translates to a different amino acid in position 193 PMID:25442384
Immunohistochemical studies showed that GnRH-receptors are expressed in vessel walls, the epidermis, the hair follicle and in sebaceous and sweat glands in canine skin and in transitional epithelium, and smooth muscle tissue in the urinary bladder. PMID:16715322
Age was negatively correlated to mRNA expression of the LH and the GnRH receptors in urinary tract. PMID:17276503