Recombinant Dog Gonadotropin-releasing hormone receptor (GNRHR)

Code: CSB-CF009637DO
Size:
20μg
20μg100μg
US$4941
Quantity:
Express system: in vitro E.coli expression system
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
GNRHR
Uniprot NO.
Alternative Names
GNRHR; Gonadotropin-releasing hormone receptor; GnRH receptor; GnRH-R
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
in vitro E.coli expression system
Expression Region
1-327
Target Protein Sequence
MASASPEQNQNHCSAVNNSNMLMQGNLPTLTLSGKIRVTVTFFLFLLSTIFNASFLLKLQ KWTQKKEKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLK LFSMYAPAFMMVVISLDRSLAITRPLAMKNNGKLGQSMIGLAWLLSGIFAGPQLYIFRMI HLADSSGQTEGFPQCVTHCSFPQWWHQAFYNFFTFSCLFIIPLFITLICNAKIIFTLTRV LHQDPHELQLNQSKNNIPRARLRTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRVS DPVNHFFFLFALLNPCFDPLIYGYFSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for gonadotropin releasing hormone (GnRH) that mediates the action of GnRH to stimulate the secretion of the gonadotropic hormones luteinizing hormone (LH) and follicle-stimulating hormone (FSH). This receptor mediates its action by association with G-proteins that activate a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. In the uterus, GnRH-R stained strongly in the surface and glandular epithelial cells, and seemed to be weaker in myometrium and stroma. These findings suggest a local regulatory function of gonadotropin releasing hormone during early canine pregnancy. PMID:26296524
  2. resequencing of canine gonadotropin-releasing hormone receptor differed from that previously published by a single base change that translates to a different amino acid in position 193 PMID:25442384
  3. Immunohistochemical studies showed that GnRH-receptors are expressed in vessel walls, the epidermis, the hair follicle and in sebaceous and sweat glands in canine skin and in transitional epithelium, and smooth muscle tissue in the urinary bladder. PMID:16715322
  4. Age was negatively correlated to mRNA expression of the LH and the GnRH receptors in urinary tract. PMID:17276503

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products