Home
Product
Protein
Transmembrane Proteins
Recombinant Dog Cytokine receptor common subunit gamma (IL2RG)

Recombinant Dog Cytokine receptor common subunit gamma (IL2RG)

Code: CSB-CF011651DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5121

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

IL2RG

Uniprot NO.

P40321

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

23-373

Target Protein Sequence

LNSTVPMPNGNEDITPDFFLTATPSETLSVSSLPLPEVQCFVFNVEYMNCTWNSSSEPRPTNLTLHYWYKNSNDDKVQECGHYLFSREVTAGCWLQKEEIHLYETFVVQLRDPREPRRQSTQKLKLQNLVIPWAPENLTLHNLSESQLELSWSNRHLDHCLEHVVQYRSDWDRSWTEQSVDHRNSFSLPSVDGQKFYTFRVRSRYNPLCGSAQRWSEWSHPIHWGSNTSKENPLFASEAVLIPLGSMGLIISLICVYYWLERSIPRIPTLKNLEDLVTEYHGNFSAWSGVSKGLAESLQPDYSEWLCHVSEIPPKGGAPGEGPGGSPCSQHSPYWAPPCYTLKPETGALIP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Common subunit for the receptors for a variety of interleukins. Probably in association with IL15RA, involved in the stimulation of neutrophil phagocytosis by IL15.

Gene References into Functions

The present study has characterized the expression of the IL-2R beta and gamma chains and the ligand IL-2 in canine cutaneous mast cell tumours PMID:23276382

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Cell surface.

Protein Families

Type I cytokine receptor family, Type 5 subfamily

Database Links

UNIGENE: Cfa.40115

KEGG: cfa:403851

STRING: 9615.ENSCAFP00000041465

Promotions