MFKSLTIKSNKVKPREENDENKQDPDPSNQPQQSTRQGENKSENKSLQTKMTPVTFEESH AKMQDKISEKNSLRDLTTNPNHQHPTESKGAMSEQKEMETGKEGLVSPKSKPLGVPVINE YADAQLHNLVRRMRQRTMLYKKKLAEGDISSPEASPQTAKPTAVPSTQESNAKLKEEHYY HILCFKFQKMPLTEYLKRFRLPGSIDSYTDRLYLLWLLLVTIAYNWNCWLIPLRLVFPYQ TPDNTHYWFITDITCDIIYLCDMLLIQPRLQFIKGGDIMVDSNELKRHYRSSTKFQLDVA SVMPFDVFYLFFGFNPVFRMNRILKYTSFFEFNHHLESIMDKAYIYRVIRTTGYLLYTLH INACIYYWASDYEGIGSTKWVYNGEGNKYLRCYYWAVRTLITIGGLPEPQTSFEIVFQLL NFFSGVFVFSSLIGQMQDVIGAATANQNNFRISMDHTISYMNTYSIPKNVQNRVRTWYEY TWDSQRMLDESDLLCTLPVTMQLALTVDVNLSIISKVELFKGCDTQMIYDMLLRLKSTVY LPGDFVCKKGEIGKEMYIIKQGEVQVLGGSDGAQVLVTLKAGAVFGEISLLAGRGGNRRT ANVIAHGFANLLTLDKKTLQEILVHYPDSEKLLMKKASVLLKKKAPATETTPPRKGLAFL FPPKQETPKIFKALLGGTGKAGLTRLLKLKREQTIQKTSENSEEGGGKRREYEDKEREPS EKILDSSECRANCIIAEEMPQSIRRAALPRGTTRQSLIISMAPSAEAGEEVLTIEVKEKA KQ
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Visual signal transduction is mediated by a G-protein coupled cascade using cGMP as second messenger. This protein can be activated by cGMP which leads to an opening of the cation channel and thereby causing a depolarization of rod photoreceptors. Induced a flickering channel gating, weakened the outward rectification in the presence of extracellular calcium, increased sensitivity for L-cis diltiazem and enhanced the cAMP efficacy of the channel when coexpressed with CNGA3. Essential for the generation of light-evoked electrical responses in the red-, green- and blue sensitive cones.
Gene References into Functions
Missense mutation at position 262 in the canine CNGB3 (D262N) subunit results in loss of cone function (daylight blindness), suggesting an important role for this aspartic acid residue in channel biogenesis.PMID:24586388
Day blindness shows genetic heterogeneity within the CNGB3 gene of the Alaskan Malamute population of Australia.PMID:16879359