Recombinant Dog CD166 antigen (ALCAM)

Code: CSB-CF001562DO
Size:
20μg
20μg100μg
US$6393
Quantity:
Express system: in vitro E.coli expression system
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
ALCAM
Uniprot NO.
Species
Canis lupus familiaris (Dog) (Canis familiaris)
Source
in vitro E.coli expression system
Expression Region
1-521
Target Protein Sequence
GSPVFIAFRSSTKKSVQYDDVPEYEDRLSLSENYTLSISNARISDEKRFVCMLVTEDNVF EAPTIVKVFKQPSKPEIVSKAPFLETEQLKKLGDCISKDSYPDGNITWYRNGKVLQPLEG VVVLIFKKQMDPVTQLYTMTSSLEYKATKADIQMQFTCSVTYYGPSGQKTVQSEQAIFDI YYPTEQVTIQVLPSKTAIKEGDIITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTLTD VRRNATGDYKCSLIDKKSMIASTAITVHYLDLSLNPSGEVTKQIGDALPVSCTISASRNA TVVWMKDNIRLRSSPSFSSLQYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKMTK KTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSTIINSPEENVT LTCTAENQLERTVNSLNVSAISIPEHDEADEISDENREQVNHRATLIVGIVLRLLHGALV AGVVYWLYVKKSKTASKHVNKDLGNLEENKKLEQNNHRTEA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cell adhesion molecule that mediates both heterotypic cell-cell contacts via its interaction with CD6, as well as homotypic cell-cell contacts. Promotes T-cell activation and proliferation via its interactions with CD6. Contributes to the formation and maturation of the immunological synapse via its interactions with CD6. Mediates homotypic interactions with cells that express ALCAM. Mediates attachment of dendritic cells onto endothelial cells via homotypic interaction. Inhibits endothelial cell migration and promotes endothelial tube formation via homotypic interactions. Required for normal organization of the lymph vessel network. Required for normal hematopoietic stem cell engraftment in the bone marrow. Plays a role in hematopoiesis; required for normal numbers of hematopoietic stem cells in bone marrow. Promotes in vitro osteoblast proliferation and differentiation. Promotes neurite extension, axon growth and axon guidance; axons grow preferentially on surfaces that contain ALCAM. Mediates outgrowth and pathfinding for retinal ganglion cell axons.
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Cell projection, axon. Cell projection, dendrite.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products