Home
Product
Protein
Transmembrane Proteins
Recombinant Dog 5-hydroxytryptamine receptor 2A (HTR2A)

Recombinant Dog 5-hydroxytryptamine receptor 2A (HTR2A)

Code: CSB-CF010887DO

Rate （N/A）
Review （0）

Size:

20μg100μg

US$6011

Quantity:

Express system: in vitro E.coli expression system

Species: Canis lupus familiaris (Dog) (Canis familiaris)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

HTR2A

Uniprot NO.

O46635

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

in vitro E.coli expression system

Expression Region

1-470

Target Protein Sequence

MDVLFEDNAPLSPTTSSLMPSNGDPRLYGNDLNAGDANTSDAFNWTVDAENRTNLSCEGC LSPPCFSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF VSFFIPLTIMVITYFLTIKSLQKEATLCVSDPGTRAKLASFSFLPQSSLSSEKLFQRSIH REPGSYGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDIIGAL LNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYKS SQLQMGQKKNSKKDAKSTDNDYSMVALGKQHSEDAPTDNINTVNEKVSCV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.

Gene References into Functions

There was a positive association between gene expression of the 5-HT2BR in the mitral valve and myocardium and clinical presence of canine myxomatous mitral valve disease. The same association was not found for the 5-HT2AR. PMID:25843893
functional existence in osteosarcoma cell line, indicating that intracellular second messenger signal coupling is different between normal and malignant cells PMID:24330646
5HT2A receptor inhibition with APD791, even when initiated after the onset of recurrent thrombosis, improves coronary patency in the in vivo canine model. PMID:19922435

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Cell projection, axon. Cytoplasmic vesicle. Membrane, caveola. Cell junction, synapse, presynapse.

Protein Families

G-protein coupled receptor 1 family

Tissue Specificity

Ubiquitous.

Database Links

UNIGENE: Cfa.8880

KEGG: cfa:403882

Promotions