gja1; cx43; shf; sof; Gap junction alpha-1 protein; Connexin-43; Cx43; Short fin protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Source
in vitro E.coli expression system
Expression Region
2-381
Target Protein Sequence
GDWSALGRLLDKVQAYSTAGGKVWLSVLFIFRILVLGTAVESAWGDEQSAFKCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSTPTLLYLAHVFYLMRKEEKLNRKEEELKAVQNDGG DVELHLKKIELKKFKHGLEEHGKVKMKGSLLRTYIFSIIFKSICEVVFLVIQWYLYGFSL SAVYTCERTPCPHRVDCFLSRPTEKTIFIIFMLVVSLFSLLLNIIELFYVLFKRIKDRVK SRQNTQFPTGTLSPTPKELSTTKYAYYNGCSSPTAPLSPMSPPGYKLATGERTNSCRNYN KQANEQNWANYSTEQNRLGQNGSTISNSHAQAFDYPDDTHEHKKLTPGHELQPLALIDAR PCSRASSRMSSRARPDDLDV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Plays an essential role in gap junction communication in the ventricles.; Plays a role in regulation of fin bone size and growth.
Gene References into Functions
Data show that Connexin43 (Cx43) was identified as the gene causing the short-of-fin (sof) phenotype, in which the fin ray segments are shorter but the vertebrae are normal.PMID:27129238
serpinh1b is molecularly and functionally downstream of cx43. The gene serpinh1b codes for a protein called Hsp47, a molecular chaperone responsible for proper folding of procollagen molecules.PMID:26103547
Hapln1a-ECM stabilizes the secreted growth factor Semaphorin3d (Sema3d), which has been independently shown to mediate Cx43 dependent phenotypes during regeneration.PMID:26828861
Hapln1a has a critical role in connexin43-dependent growth and patterning in the regenerating fin skeletonPMID:24533114
increased expression in Dupuytren's diseasePMID:24359029
Sema3d functions in a common molecular pathway with Cx43 cell proliferation and joint formationPMID:22542598
Data show that the cultured fibroblasts from patients with ossification of the posterior longitudinal ligament (OPLL) exhibited osteogenic characteristics, in which Cx43 played an important role.PMID:21311398
Studies indicate that Cardiomyogenesis is determined by stimuli from the cellular microenvironment, where connexin43 may play an important role.PMID:21931658
Data demonstrate a cross-talk between IGF-1R and AT-1R in AT-II and IGF-1-induced Cx43 expression in SV SMCs involving Erk 1/2 and downstream activation of the AP-1 transcription factor.PMID:20731749
These results of this study suggested that alterations of astrocyte connexins might be involved in the suicide process and provide further evidence implicating astrocytes in psychopathology.PMID:21571253
Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblastsdepend of Cx43 rather than on Cx45.PMID:21674053
Critical role of connexin43 in zebrafish late primitive and definitive hematopoiesis.PMID:20020200
Cx43 is crucial for TJ reassembly at the blood-testis barrier during its cyclic restructuring throughout the seminiferous epithelial cycle of spermatogenesisPMID:20921394
Neonatal murine atrial myocytes showed similar abundances of Cx40 and Cx43 proteins, while ventricular myocytes contained at least 20 times more Cx43 than Cx40.PMID:19486903
There was a lack of membranous distribution of connexins or a shift from moderately membranous immunoreactivity to predominantly cytoplasmic accumulation of CX32 and CX43 in studied colon tumors.PMID:20133984
Cx48.5, Cx44.1, Cx43 have roles in lens developmentPMID:14648847
The fin length mutant short fin (sof), which causes defects in the length of bony fin ray segments, is caused by mutations in the connexin43 (cx43) gene.PMID:15649473
molecular cloning; Cx43alpha1 gap junctions are likely to have conserved roles in vertebrate embryonic developmentPMID:15895415
Measurable differences in Cx43 function may be correlated with the severity of defects in bone length.PMID:17599838
Connexin43 (GJA1) is required in the population of dividing cells during fin regeneration.PMID:18406403
Results reveal a correlation between the level of Cx43 expression in the fin ray mesenchyme and the location of joints in developing zebrafish.PMID:19150347
role of Cx43.4 appears to be conserved given that its ortholog, human Cx45, is able to functionally compensate for zebrafish Cx43.4 during L-R patterningPMID:19799895
Show
More
Hide
All
Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
Expressed in adult ovary, heart, lens and liver. In growing caudal fins, expressed in cells flanking the germinal region of newly growing segments and in osteoblasts at segment boundaries.