Recombinant Danio rerio Gap junction alpha-1 protein (gja1)

Code: CSB-CF009443DIL
Size:
20μg
20μg100μg
US$5338
Quantity:
Express system: in vitro E.coli expression system
Species: Danio rerio (Zebrafish) (Brachydanio rerio)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
gja1
Uniprot NO.
Alternative Names
gja1; cx43; shf; sof; Gap junction alpha-1 protein; Connexin-43; Cx43; Short fin protein
Species
Danio rerio (Zebrafish) (Brachydanio rerio)
Source
in vitro E.coli expression system
Expression Region
2-381
Target Protein Sequence
GDWSALGRLLDKVQAYSTAGGKVWLSVLFIFRILVLGTAVESAWGDEQSAFKCNTQQPGC ENVCYDKSFPISHVRFWVLQIIFVSTPTLLYLAHVFYLMRKEEKLNRKEEELKAVQNDGG DVELHLKKIELKKFKHGLEEHGKVKMKGSLLRTYIFSIIFKSICEVVFLVIQWYLYGFSL SAVYTCERTPCPHRVDCFLSRPTEKTIFIIFMLVVSLFSLLLNIIELFYVLFKRIKDRVK SRQNTQFPTGTLSPTPKELSTTKYAYYNGCSSPTAPLSPMSPPGYKLATGERTNSCRNYN KQANEQNWANYSTEQNRLGQNGSTISNSHAQAFDYPDDTHEHKKLTPGHELQPLALIDAR PCSRASSRMSSRARPDDLDV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell. Plays an essential role in gap junction communication in the ventricles.; Plays a role in regulation of fin bone size and growth.
Gene References into Functions
  1. Data show that Connexin43 (Cx43) was identified as the gene causing the short-of-fin (sof) phenotype, in which the fin ray segments are shorter but the vertebrae are normal. PMID:27129238
  2. serpinh1b is molecularly and functionally downstream of cx43. The gene serpinh1b codes for a protein called Hsp47, a molecular chaperone responsible for proper folding of procollagen molecules. PMID:26103547
  3. Hapln1a-ECM stabilizes the secreted growth factor Semaphorin3d (Sema3d), which has been independently shown to mediate Cx43 dependent phenotypes during regeneration. PMID:26828861
  4. Hapln1a has a critical role in connexin43-dependent growth and patterning in the regenerating fin skeleton PMID:24533114
  5. increased expression in Dupuytren's disease PMID:24359029
  6. Sema3d functions in a common molecular pathway with Cx43 cell proliferation and joint formation PMID:22542598
  7. Data show that the cultured fibroblasts from patients with ossification of the posterior longitudinal ligament (OPLL) exhibited osteogenic characteristics, in which Cx43 played an important role. PMID:21311398
  8. Studies indicate that Cardiomyogenesis is determined by stimuli from the cellular microenvironment, where connexin43 may play an important role. PMID:21931658
  9. Data demonstrate a cross-talk between IGF-1R and AT-1R in AT-II and IGF-1-induced Cx43 expression in SV SMCs involving Erk 1/2 and downstream activation of the AP-1 transcription factor. PMID:20731749
  10. These results of this study suggested that alterations of astrocyte connexins might be involved in the suicide process and provide further evidence implicating astrocytes in psychopathology. PMID:21571253
  11. Gap junctional intercellular communication in human bladder smooth muscle cells and suburothelial myofibroblastsdepend of Cx43 rather than on Cx45. PMID:21674053
  12. Critical role of connexin43 in zebrafish late primitive and definitive hematopoiesis. PMID:20020200
  13. Cx43 is crucial for TJ reassembly at the blood-testis barrier during its cyclic restructuring throughout the seminiferous epithelial cycle of spermatogenesis PMID:20921394
  14. Neonatal murine atrial myocytes showed similar abundances of Cx40 and Cx43 proteins, while ventricular myocytes contained at least 20 times more Cx43 than Cx40. PMID:19486903
  15. There was a lack of membranous distribution of connexins or a shift from moderately membranous immunoreactivity to predominantly cytoplasmic accumulation of CX32 and CX43 in studied colon tumors. PMID:20133984
  16. Cx48.5, Cx44.1, Cx43 have roles in lens development PMID:14648847
  17. The fin length mutant short fin (sof), which causes defects in the length of bony fin ray segments, is caused by mutations in the connexin43 (cx43) gene. PMID:15649473
  18. molecular cloning; Cx43alpha1 gap junctions are likely to have conserved roles in vertebrate embryonic development PMID:15895415
  19. Measurable differences in Cx43 function may be correlated with the severity of defects in bone length. PMID:17599838
  20. Connexin43 (GJA1) is required in the population of dividing cells during fin regeneration. PMID:18406403
  21. Results reveal a correlation between the level of Cx43 expression in the fin ray mesenchyme and the location of joints in developing zebrafish. PMID:19150347
  22. role of Cx43.4 appears to be conserved given that its ortholog, human Cx45, is able to functionally compensate for zebrafish Cx43.4 during L-R patterning PMID:19799895

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Protein Families
Connexin family, Alpha-type (group II) subfamily
Tissue Specificity
Expressed in adult ovary, heart, lens and liver. In growing caudal fins, expressed in cells flanking the germinal region of newly growing segments and in osteoblasts at segment boundaries.
Database Links

UNIGENE: Dr.75809

KEGG: dre:30236

STRING: 7955.ENSDARP00000061260

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products