MKMSRSEHSLQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTNHDYPPGLLI AFSACTTVLVAVHLFALMVSTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTV IGTLLFLAGVVLLCWVKFLPIKPKGQKNGTVSAGVAAAITSTSIMVPFGLVFIVFAVHFY RSLVSHKTDRQFQELEELEDLQNELDHREEVSTLQSPGSLYP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.
Gene References into Functions
Orai1 is localized to the cleavage furrow during cytokinesis of the first and second cell division cycles in zebrafish embryos.PMID:27702423
The findings identify ORAI1 as an important regulator of cardiac and skeletal muscle function and provide evidence linking ORAI1-mediated calcium signaling to sarcomere integrity and cardiomyocyte function.PMID:22302996