Home
Product
Protein
Transmembrane Proteins
Recombinant Danio rerio Calcium release-activated calcium channel protein 1 (orai1)

Recombinant Danio rerio Calcium release-activated calcium channel protein 1 (orai1)

Code: CSB-CF761459DIL

Rate （N/A）
Review （0）

Size:

20μg100μg

US$4156

Quantity:

Express system: in vitro E.coli expression system

Species: Danio rerio (Zebrafish) (Brachydanio rerio)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

orai1

Uniprot NO.

Q6TLE6

Alternative Names

orai1; tmem142a; zgc:109721; Calcium release-activated calcium channel protein 1; Protein orai-1; Transmembrane protein 142A

Species

Danio rerio (Zebrafish) (Brachydanio rerio)

Source

in vitro E.coli expression system

Expression Region

1-222

Target Protein Sequence

MKMSRSEHSLQALSWRKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLDTNHDYPPGLLI AFSACTTVLVAVHLFALMVSTCILPNIEAVSNVHNLNSVKESPHERMHRHIELAWAFSTV IGTLLFLAGVVLLCWVKFLPIKPKGQKNGTVSAGVAAAITSTSIMVPFGLVFIVFAVHFY RSLVSHKTDRQFQELEELEDLQNELDHREEVSTLQSPGSLYP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Ca(2+) release-activated Ca(2+) (CRAC) channel subunit which mediates Ca(2+) influx following depletion of intracellular Ca(2+) stores.

Gene References into Functions

Orai1 is localized to the cleavage furrow during cytokinesis of the first and second cell division cycles in zebrafish embryos. PMID:27702423
The findings identify ORAI1 as an important regulator of cardiac and skeletal muscle function and provide evidence linking ORAI1-mediated calcium signaling to sarcomere integrity and cardiomyocyte function. PMID:22302996

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

Orai family

Database Links

UNIGENE: Dr.85339

KEGG: dre:402892

STRING: 7955.ENSDARP00000022726

Promotions