Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 1 (LAMP1)

Code: CSB-CF012738DXU
Size:
20μg
20μg100μg
US$5383
Quantity:
Express system: in vitro E.coli expression system
Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
LAMP1
Uniprot NO.
Alternative Names
LAMP1; LGPA; Lysosome-associated membrane glycoprotein 1; LAMP-1; Lysosome-associated membrane protein 1; CD107 antigen-like family member A; Lysosomal membrane glycoprotein A; LGP-A; CD antigen CD107a
Species
Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Source
in vitro E.coli expression system
Expression Region
22-407
Target Protein Sequence
ASALFVVKDSNGTACIMANFSASFFTIYETGHGSKNSTFELPSSAEVLNSNSSCGRENVSEPILTIAFGSGYLLTLNFTRNATRYSVQDMYFAYNLSDTQHFLNASNKGIHSVDSSTDIKADINKTYRCLSAIQVHMGNVTVTLSDATIQAYLLNSNFSKEETRCTQDGPSPTTVPPSPSPPLVPTNPTVIKYNVTGENGTCLLASMALQMNITYMKKDNMTVTRALNISPNDTASGSCSPHVVTLTVESKNSILDLKFGMNGSSSLFFLQEVRLNMTLPDANVSSLMASNQSLRALQATVGNSYKCNTEEHIFVTKEFSLNVFSVQVQAFKVESDRFGSVEECMQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, autophagy, and cholesterol homeostasis. Plays also an important role in NK-cells cytotoxicity. Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.
Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Cytolytic granule membrane; Single-pass type I membrane protein.
Protein Families
LAMP family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products