Home
Product
Protein
Transmembrane Proteins
Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 1 (LAMP1)

Recombinant Cricetulus griseus Lysosome-associated membrane glycoprotein 1 (LAMP1)

Code: CSB-CF012738DXU

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5383

Quantity:

Express system: in vitro E.coli expression system

Species: Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

LAMP1

Uniprot NO.

P49129

Species

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Source

in vitro E.coli expression system

Expression Region

22-407

Target Protein Sequence

ASALFVVKDSNGTACIMANFSASFFTIYETGHGSKNSTFELPSSAEVLNSNSSCGRENVSEPILTIAFGSGYLLTLNFTRNATRYSVQDMYFAYNLSDTQHFLNASNKGIHSVDSSTDIKADINKTYRCLSAIQVHMGNVTVTLSDATIQAYLLNSNFSKEETRCTQDGPSPTTVPPSPSPPLVPTNPTVIKYNVTGENGTCLLASMALQMNITYMKKDNMTVTRALNISPNDTASGSCSPHVVTLTVESKNSILDLKFGMNGSSSLFFLQEVRLNMTLPDANVSSLMASNQSLRALQATVGNSYKCNTEEHIFVTKEFSLNVFSVQVQAFKVESDRFGSVEECMQDGNNMLIPIAVGGALAGLVLIVLIAYLIGRKRSHAGYQTI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Lysosomal membrane glycoprotein which plays an important role in lysosome biogenesis, autophagy, and cholesterol homeostasis. Plays also an important role in NK-cells cytotoxicity. Mechanistically, participates in cytotoxic granule movement to the cell surface and perforin trafficking to the lytic granule. In addition, protects NK-cells from degranulation-associated damage induced by their own cytotoxic granule content. Presents carbohydrate ligands to selectins. Also implicated in tumor cell metastasis.

Subcellular Location

Cell membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Cytolytic granule membrane; Single-pass type I membrane protein.

Protein Families

LAMP family

Database Links

KEGG: cge:100689406

Promotions