YLVNPAAYAALGAYMFLLILIGFPINFLTLYVTLEHKKLRTPLNYILLNLAVGNLFMVLG GFTTTMYTSMHGYFVLGRLGCNLEGFFATLGGEIALWSLVVLAIERWIVVCKPISKFRFT EDHAIMGLAFSWVMGLACAVPPLVGWSRYIPEGMKCSCGVDYYTRAEGFNNESFVIYMFI VHFLIPLSVIFFCYGRLLCAVKEAAAAQQESETTQRAEKEVSRMVVIMVIGFLVCWLPYA SVAWWIFCNQGSDFGPIFMTLPSFFAKRPAIYNPMIYICMNKQFRHCMI
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
full length protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Photoreceptor required for image-forming vision at low light intensity. While most salt water fish species use retinal as chromophore, most freshwater fish use 3-dehydroretinal, or a mixture of retinal and 3-dehydroretinal. Light-induced isomerization of 11-cis to all-trans retinal triggers a conformational change that activates signaling via G-proteins. Subsequent receptor phosphorylation mediates displacement of the bound G-protein alpha subunit by arrestin and terminates signaling.