Recombinant Chlorocebus aethiops Membrane cofactor protein (CD46)

Code: CSB-CF004939DSU
Size:
20μg
20μg100μg
US$5001
Quantity:
Express system: in vitro E.coli expression system
Species: Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Tag Info: N-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Target Names
CD46
Uniprot NO.
Species
Chlorocebus aethiops (Green monkey) (Cercopithecus aethiops)
Source
in vitro E.coli expression system
Expression Region
35-369
Target Protein Sequence
CEAPPTFEAMELIGKPKPYYKVGERVDYKCKKGYFYVPPLATHSICDRNHTWLPVSDEGCYREMCPHIRDPLNGEAILANGSYEFGSELHFICNEGYYLIGKDILYCELKDTVAVWSGKPPLCEKILCTPPPKIKNGKHTFSEVEVFEYLDAVTYSCDPAPGPDPFSLIGESMIYCGNNSTWSHAAPECKVVKCRFPVVENGKQISGFGKKFYYKATVMFECDKGYYLNGSDKIVCESNSTWDPPVPKCLKGPRPTYKPPVSNYPGYPKPDEGILDSLDDWVIALIVIVIVVAVAVICVALYRFLQGRKKKGKADGGPEYATYQTKSTPPAEQRG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Acts as a cofactor for complement factor I, a serine protease which protects autologous cells against complement-mediated injury by cleaving C3b and C4b deposited on host tissue. May be involved in the fusion of the spermatozoa with the oocyte during fertilization. Also acts as a costimulatory factor for T-cells which induces the differentiation of CD4+ into T-regulatory 1 cells. T-regulatory 1 cells suppress immune responses by secreting interleukin-10, and therefore are thought to prevent autoimmunity.
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome inner membrane; Single-pass type I membrane protein.
Tissue Specificity
Present at the membrane of erythrocytes and lymphocytes (at protein level).
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products