Home
Product
Protein
Transmembrane Proteins
Recombinant Chicken Type-1 angiotensin II receptor (AGTR1)

Recombinant Chicken Type-1 angiotensin II receptor (AGTR1)

Code: CSB-CF001465CH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5181

Quantity:

Express system: in vitro E.coli expression system

Species: Gallus gallus (Chicken)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

AGTR1

Uniprot NO.

P79785

Alternative Names

AGTR1; Type-1 angiotensin II receptor; Angiotensin II type-1 receptor; AT1

Species

Gallus gallus (Chicken)

Source

in vitro E.coli expression system

Expression Region

1-359

Target Protein Sequence

MVPNYSTEETVKRIHVDCPVSGRHSYIYIMVPTVYSIIFIIGIFGNSLVVIVIYCYMKLK TVASIFLLNLALADLCFLITLPLWAAYTAMEYQWPFGNCLCKLASAGISFNLYASVFLLT CLSIDRYLAIVHPVKSRIRRTMFVARVTCIVIWLLAGVASLPVIIHRNIFFAENLNMTVC GFRYDNNNTTLRVGLGLSKNLLGFLIPFLIILTSYTLIWKTLKKAYQIQRNKTRNDDIFK MIVAIVFFFFFSWIPHQVFTFLDVLIQLHVITDCKITDIVDTAMPFTICIAYFNNCLNPF FYVFFGKNFKKYFLQLIKYIPPNVSTHPSLTTKMSSLSYRPPENIRLPTKKTAGSFDAE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Storage Condition

Store at -20°C, for extended storage, conserve at -20°C or -80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor for angiotensin II. Mediates its action by association with G proteins that activate a phosphatidylinositol-calcium second messenger system.

Gene References into Functions

In contrast to the authors' previous genome wide association study and microsatellite data, they find no association of the SNP genotypes or haplotypes in the region between 11.8 and 13.6 Mbp on chromosome 9, suggesting that the AGTR1 and UTS2D genes might have limited association with the disease phenotype. PMID:28339549
investigation of gene expression and role of Ang II receptor during embryonic development: expression in CAM and heart of embryo; limited effect of Ang II receptor antagonist on blood pressure of embryo PMID:20495810

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family

Database Links

UNIGENE: Gga.632

KEGG: gga:396065

STRING: 9031.ENSGALP00000039674

Promotions