Recombinant Chicken Synaptotagmin-1 (SYT1)

Code: CSB-CF023029CH

Rate （N/A）
Review （0）

Size:

20μg100μg

US$5667

Quantity:

Express system: in vitro E.coli expression system

Species: Gallus gallus (Chicken)

Tag Info: N-terminal 10xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Target Names

SYT1

Uniprot NO.

P47191

Species

Gallus gallus (Chicken)

Source

in vitro E.coli expression system

Expression Region

1-424

Target Protein Sequence

MVSESHHEALAAPPATTVAAALPSNVTEPAAPGGGGGKEDAFSNLKKKFMNELNKIPLPPWALIAIAIVAVLLILTCCFCLCKKCLFKKKNKKKGKEKGGKNAINMKDVKDLGKTMKDQALKDDDAETGLTDGEEKEEPKEVEKLGKIQYSLDYDFQNNQLLVGIIQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPVFNEQFTFKVPYSELGGKTLVMAVYDFDRFSKHDIIGEYKVAMNTVDFGHVTEEWRDLQSAEKEEQEKLGDICFSLRYVPTAGKLTVVILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTIKKNTLNPYYNESFSFEVPFEQIQKVQIVVTVLDYDKIGKNDAIGKVFVGYNSTGAELRHWSDMLANPRRPIAQWHTLQPEEEVDAMLAVKK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

full length protein

Tag Info

N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Calcium sensor that participates in triggering neurotransmitter release at the synapse. May have a regulatory role in the membrane interactions during trafficking of synaptic vesicles at the active zone of the synapse. It binds acidic phospholipids with a specificity that requires the presence of both an acidic head group and a diacyl backbone. May play a role in dendrite formation by melanocytes.

Gene References into Functions

The data of this study indicated that syt1 regulates the formation of axonal filopodia and branches before engaging in its conventional functions at the synapse. PMID:22589224
Quantitative immunocytochemistry at an isolated calyx-type presynaptic terminal indicates that this complex is associated with SYT1 at the presynaptic transmitter release face but not with synaptotagmin 1 on intracellular synaptic vesicles PMID:17183698

Hide All

Subcellular Location

Cytoplasmic vesicle, secretory vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane; Single-pass membrane protein. Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Single-pass membrane protein. Cytoplasm.

Protein Families

Synaptotagmin family

Database Links

UNIGENE: Gga.643

KEGG: gga:396083

STRING: 9031.ENSGALP00000016781

Promotions